SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g111500.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g111500.2.1
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-22
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 420-491
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000392
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g111500.2.1
Sequence length 501
Comment genomic_reference:SL2.40ch03 gene_region:56155588-56162558 transcript_region:SL2.40ch03:56155588..56162558- go_terms:GO:0005737,GO:0006355 functional_description:"B3 domain-containing protein Os01g0905400 (AHRD V1 *-*- Y1054_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MECENEACGGCKKDCMLIHGKGVLSFFKVMIDKSFLQVLFFPPKFARSVPHLTDQETYLE
DSSGHRWRVTVCNHKGSLSIRQGWPKFSSDHGLDVGDFLVFHYVPGQHFIVKIFGTSGCE
KKSCSDIGNGRKRARTYLEATAQAELFQTTDINSVKKKSKTSAESESETVTHKTNTANFK
TSAESESEKVRYKANAANFKTSAESESEKVTYKPSTANFTTNINADIGKGQSVHSAIDVD
ESCCVIDRNAQYDQEDDRLCLHLSSFEMPASKPLTVGTSSPFKGDIGKDNQVEANFRSQT
ESNLNVEIDNLNSKAPWSKLEAGIRATNMVSSPAKDIPLRYPKYKKSNEASQFAREAMLV
KKEFEEITTEAFSPARAIHGGEYANGNEKVIKSEPADSGDARSLNAGSYSCLVEIDGRDF
LELPESWRKYLPQKAKLGRMIIYLRGQDKRIWPTLYNSRSGFNVLTCGWKQVTATYGLNP
GDECLFQLVNQRGCIFDIRKI
Download sequence
Identical sequences K4BK13
Solyc03g111500.2.1 XP_010319046.1.44838 XP_010319047.1.44838 Solyc03g111500.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]