SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc03g118290.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g118290.2.1
Domain Number 1 Region: 142-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 717-797
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000172
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g118290.2.1
Sequence length 846
Comment genomic_reference:SL2.40ch03 gene_region:61268685-61276156 transcript_region:SL2.40ch03:61268685..61276156+ go_terms:GO:0005515,GO:0003700 functional_description:"Auxin response factor 2 (AHRD V1 **** Q2LAJ3_SOLLC); contains Interpro domain(s) IPR011525 Aux/IAA-ARF-dimerisation IPR003340 Transcriptional factor B3 "
Sequence
MAASEVSIQGYSEPSDGSRPVSETGRSSSGVGIVDADTALYTELWRSCAGPLVTVPREGE
LVYYFPQGHIEQVEASTNQVADQQMPLYNLPSKILCRVVNVLLKAEPDTDEVYAQVTLMP
EPNQDENAVKKEPMRPPPPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPQLDMSRQ
PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGEL
RVGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPRTSPAEFIVPYD
HYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWLESKWRCLKVRWDEN
SSIPRPDRVSPWKIEPALSPPALNVPPVARPKRPRSSILPTSPDSSVLTREGSSRATADH
SQASGFPRVLQGQELSTFRGGFAEINETDLSEKPMIWQTSVNDEKNDIHSASKRYLPDKW
LPLGRPESSLTDLLSGFGSSHGFCLPSADQAAFGARLVKQQTQDQEKDFSLLGKPWSLLS
SGLSLNLMDSGSKAPGIGGDTPYQMRGDARYSGYGEFSVLPGHRVANQQGSWIMPQPVSP
YMQLSSHSREMMHKPSVVKQPEAVKPKEGNYKLFGIPLTSNVCTDAVMMRKSSLIDPASD
MNIGIHPHQSLATDSDQRSEQSKGSKVDDGVAANDHDKQFHTFHLAARDKDGKGHSSSTR
SCTKVHKQGTALGRSVDLAKFNNYDELIAELDQLFDFNGELKARSKSWLVVYTDDEGDMM
LVGDDPWQEFCGMVRKIFIYTKEEVQRMNPGTLNSKGEDTSSVAEGSDAKEVKNLQLPSE
SGQAES
Download sequence
Identical sequences Q2LAJ3
Sopim03g118290.0.1 Solyc03g118290.2.1 Solyc03g118290.2.1 NP_001233765.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]