SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc04g079590.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g079590.2.1
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-24
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.49e-23
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 456-556
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-23
Family B3 DNA binding domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc04g079590.2.1
Sequence length 580
Comment genomic_reference:SL2.40ch04 gene_region:61597480-61603476 transcript_region:SL2.40ch04:61597480..61603476+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os03g0619600 (AHRD V1 ***- Y3196_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MLDARRPHFLVGFNPFMNSEKLKIPSKFIKHMEGGDSGTTVLVGPSGNAWPVDLIQQDDG
LFFNNGWVSFVKDHCLETGDSLVFRYDGDLHFTVQVFDESSCEKEASYNADCSQGATDLY
NLALKKRDRGNSVLLDCMVEGVPKKMKSTEIPSECTSSQDTHGLASSKDGYTPEDAVCSY
AGRNYAASFLDEMENAGDALNSKVTIAVPAQAKIIFSNPGNASSEKDMWLPAQEAEKVAG
LFTSSLPSFTKVMKRFNISGSYTLHIPYQFATEHLPNCKVKILLHNLEGKTWTVNSIPTT
RVQTSHTFCGGWLSFVRDNNIDLGDTCIFELVRKCELRVRVLKAEKEGSDYSSKVVDEGL
VIDYAKNSGCKSRKVGSSSDQAKVMTYDKKGSTPEKEKHGDMLKNHQLHSQSKISSGDSA
IRKPTSSQDKQGSFTKSCMSMKSVPEEKLAAESFISNFPHFVRIMKKFNISGSYTLKVPC
RFSMEHLPNCRTEIVLQNLKGECWTVNSIPTVKVQTLHTFCGGWSAFVRENDIQMGDICI
FELIGKYEMRVHVCAIGKKGLDYQNGTAPKESDILASLTS
Download sequence
Identical sequences K4BV42
Solyc04g079590.2.1 XP_019069240.1.44838 Solyc04g079590.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]