SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g056040.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g056040.2.1
Domain Number 1 Region: 124-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.02e-28
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc05g056040.2.1
Sequence length 650
Comment genomic_reference:SL2.40ch05 gene_region:64568906-64574482 transcript_region:SL2.40ch05:64568906..64574482- go_terms:GO:0005634,GO:0006355 functional_description:"Auxin response factor 14 (AHRD V1 *-*- D9HNU1_MAIZE); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MVDQLRFSQQKYLNHMPFKGDDDLCREIWKACSGSLLDVSKAGERVYYFPRLHVEQLEQS
SNQELIEKLQLSNLPPKILCRVLHIRLLVEHETEEVYAETILIPNQDQNEPTAADFSPLD
NPRPQFQSFCKCLTQSDIKSNWGLSVPLKDAVKCFPPLDMRQEKPCQELIAKDLKGNEWR
FKHAHQGQPRRHSLTNGWSTFVTSKKLLAGDLVVFLRDETGKLHVGIRRLSYQHCSVGAS
TFSRQSMEVVLAVASHAFATKSLFFVYQKPCYNKSSQFIMSMSKYFEGGNHGIGVGMISR
MQIESEDYCHVRRTNDLEQISLSQSQQTTNFMLEEDQYMQDSEAVLDCAQSTMIDLEIRQ
QTIGSLNNIHCFAPVEDNGLQLHAAVARENNEGSIPKDTVSTHTRDEDLYELFKDFDFPD
STNTSLDTIALDLGSDWFRSTLQEQEETVTPSQPNASEDHSRRTSSVLEHPNSFRVMSIS
SNPSQIPYEGPGRGDEQVPWGGYQVARRTLPILSRVVSRYPDSLVNFRVASSILQSVYLE
ILAELVYFLDNLTIVNLSKDQFNVARQHIWDLKLSGIEIGWLENRLLHIDEVFSMESLLQ
RRQALTRRMEETFKQLDGELGCIDKELHELSLKVGPNSPMRLQSVLEGLL
Download sequence
Identical sequences K4C2S9
NP_001303697.1.44838 Solyc05g056040.2.1 Solyc05g056040.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]