SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc06g074160.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g074160.1.1
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-19
Family B3 DNA binding domain 0.00074
Further Details:      
 
Domain Number 2 Region: 154-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.77e-16
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g074160.1.1
Sequence length 254
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch06 gene_region:42252005-42253561 transcript_region:SL2.40ch06:42252005..42253561- go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os03g0212300 (AHRD V1 ***- Y3123_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MERNYVGNGFPAFIKVYSPETCYLKLKIPSRFFKNLNGDIPVISLLEVEGSARRSWRVVI
EKIEEDFYFKGGWTKFVQDNNLENEDYLNFLYAGNSTFSVKIYGTNGYLKQELNAIAELE
LHPLDEENPNEIQVVSPLADEELDGSENSLVSVTLFEIVMKKSNFSNMLLNFPSTFGKKY
MKRGQVFEKMATLQTDGKSWPVVVRSSDRLKLRKGWRQYLQDNDLHVGDVLRFKLIDEEN
FILKVLIRRITFDC
Download sequence
Identical sequences K4C9D4
XP_004242112.1.44838 Solyc06g074160.1.1 Solyc06g074160.1.1 Sopim06g074160.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]