SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc07g016180.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g016180.2.1
Domain Number 1 Region: 125-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-43
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 1017-1079
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000118
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc07g016180.2.1
Sequence length 1112
Comment genomic_reference:SL2.40ch07 gene_region:6386861-6394308 transcript_region:SL2.40ch07:6386861..6394308- go_terms:GO:0046983 functional_description:"Auxin response factor 19 (AHRD V1 ***- D9IA29_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MKTPVNTAGVQQQHTVNGNPGEVEKKSINPELWQACAGPLVNLPAAGTHVVYFPQGHSEQ
VAASMKKDVDAQIPNYPNLPSKLVCLLHNITLHADPETDEVYAQMTLQPVPSFDKEALLR
SDLSMKANKPQTEFFCKTLTASDTSTHGGFSVPRRSAEKIFPPLDYSMQPPAQELVARDL
HDNLWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRRANRQP
TNLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVIPLAKYYKATYSSQV
SLGMRFRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGERRNRVS
IWEIEPVTAPFFICPTPPFFRSKRPRLPGMPDDDCSDLDGLFKRTMPWLGDDFGMKDPQG
LPGLSLVQWMNMQQNPSLANSMQPNYLHSLSGSVLQNVGGGADLSRQLCLPAPQLPQQNT
LQFGSQRPTQQVQQLDQLQKIPTTTLSPAGSIMQPQQQLSDISQQPRQNLINQSVPTNHV
QAQLLQAQSLVQSQNVLQQQQSFQNQLQRNLPQNLPQQQQIMNQTQQQSFMQPQPSDPLN
QQLHFSDNQLQMQLLQKLQQQSLLAQQSLLQQPSQLMPIQDQQKHLDVSQNFSRSLATSQ
MLDMSQTTSNSTSLSQPQVAQQQMTINNSQSNLRFAQPNQHMKQQQQQQQPGILPEIPGQ
VGQILPPTTNQLSANCSSFLTGAVGGGQSVVTDDIPSCSTSPSTNNCQNVVQPIMNGRIH
RGTAAAEETTQSSLPLLSSSGLEAMSPNRNLVKDLQQKPDVKPSMNISKSQNHGFSTPQT
YLNNAVPQMDYLDSSSSATSVYFSQNDVQLQQTTNPMSFSSQAIVFRDSQDGEVQGDPRH
SVAFGANMDNQLGISMMPDSLITNSLVGSRKDVSNNISSGGGMLSSYENPKDAQPELSSS
MVSQSFGVPDMAFNSIDSTINEGSFMNRGAWAPPPQMPRMRTFTKVHKRGAVGRSIDIAR
YSGYEELKQDLARRFGIEGQLEDRQRIGWKLVYVDHENDVLLVGDDPWEEFVNCVRCIKI
LSPQEVQQISLDGDFGNNVQNQACSSSDGGNV
Download sequence
Identical sequences K4CCD5
NP_001234740.2.44838 Solyc07g016180.2.1 Solyc07g016180.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]