SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc08g006240.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g006240.1.1
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-19
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 153-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-19
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 3 Region: 385-477
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000112
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 4 Region: 276-367
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000157
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc08g006240.1.1
Sequence length 504
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch08 gene_region:921931-925834 transcript_region:SL2.40ch08:921931..925834+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein LOC_Os12g40080 (AHRD V1 ***- Y1208_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MKIPPKKPQFLKPIHKGFKHGLKIPIGFLKYLKGHDQHEHAILRSAGKTWLVKVNGWRLE
EGWKKFANENDLHLGDMLVFRHEGDMEFEVSIFDSSHCDREYAEYLQQEAGFNNVEETCK
KFEFKGKSNLCIMSSGEALPYAEAATYNPCSRSHFECIVKPYCITHSYLRLPKHFAMEND
IFNKKCDVIIRDERQRSWKLRLATHDCRVHLLGGWREFRVANDLNVGDYMMFEVIANGEK
PIWKFRGDKPNANIVSTRKAFPKEEFATCSSFTQSHVECIVRPYCLKRNYYRLPRGFARA
NGLINTKCGLVIRDERQRSWNLRIDTYGYGVYIAKGWSKFRVENDLKEGDRMMFEVVSNG
EKPIWKFYGTNTNKNKNKNKPFAQSHFVCIIRPYCLVNDFLYIPTKIAHAYRLTNKKCDL
VIRDDRRERSWNVKLRSFGNSVCIKGGWRVFRDANCLKEGDCIMFEVVSNGENTTWKYNG
KISTKDHKKPIDKDNVKKLVMGKH
Download sequence
Identical sequences K4CIB3
Sopim08g006240.0.1 Solyc08g006240.1.1 Solyc08g006240.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]