SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc08g006270.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc08g006270.1.1
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-19
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc08g006270.1.1
Sequence length 195
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch08 gene_region:948787-953241 transcript_region:SL2.40ch08:948787..953241+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein REM1 (AHRD V1 *-*- REM1_BRAOB); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MFEVVTNGKQPVWKIHHLTNPSTVEEPSENSVFKETAPHNPIGQSHFECFLRPYCISKGY
LRLPKQFSMANGLINKKCGLIIRDERERSWNLRLYTHNSIVHILGGWSEFCVANDLKEGD
YMMFEVVVNGEKPIWKFHNKPTPSIKSSRNVEAANHKPADHSRFVCTIKPYCLTYGYLCL
PKQFVDGISSVRHIA
Download sequence
Identical sequences K4CIB6
Solyc08g006270.1.1 Solyc08g006270.1.1 Sopim08g006270.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]