SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc09g010230.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc09g010230.1.1
Domain Number 1 Region: 57-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-30
Family B3 DNA binding domain 0.0000174
Further Details:      
 
Weak hits

Sequence:  Solyc09g010230.1.1
Domain Number - Region: 190-248
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.000471
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc09g010230.1.1
Sequence length 345
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch09 gene_region:3624972-3628689 transcript_region:SL2.40ch09:3624972..3628689+ go_terms:GO:0003700 functional_description:"Auxin response factor 24 (AHRD V1 *-** D9HNV1_MAIZE); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MSINHISSETFWWTKKQPPSFPNMFEFNLNNNMNNNSTNEDDELVQNEDKFEEIPRDHLF
EKPLTPSDVGKLNRLVIPKQHAEKYFPLSGSNNSNSNNNNIDGGTEKGLLLSFEDESGKS
WRFRYSYWNSSQSYVLTKGWSRFVKEKRLDAGDIVLFDRHRSDTDRLFIGWRRRNIISAP
ISTAAVRHNTAAAMTGNIGGGGGGWAHVYYGGHPYPRAGAGLPYQPDCLHAGRGAMQNQT
TTSVNNNTRRHVRLFGVNLECEADDSSWSEPPPTPDGGGSSTSSHHQDHGRSQDQASQHY
YQYQFQYSKPHVAVSATASSYNNNHHNHKDMNFSRDVNQMRYHQG
Download sequence
Identical sequences K4CR51
Sopim09g010230.0.1 Solyc09g010230.1.1 XP_004246879.2.44838 Solyc09g010230.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]