SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc11g069500.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc11g069500.1.1
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.62e-29
Family B3 DNA binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  Solyc11g069500.1.1
Domain Number - Region: 590-662
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0173
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc11g069500.1.1
Sequence length 699
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch11 gene_region:51188434-51191569 transcript_region:SL2.40ch11:51188434..51191569- go_terms:GO:0046982,GO:0005516 functional_description:"Auxin response factor 16 (AHRD V1 ***- D9IVB4_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MKEVLEKCVDSQLWHACAGGMVQIPPVNSKVYYFPQGHAEHTLMNVDFSALPRSPALILC
RVAAVKFLADPETDEVYAKIRVVPVGNKGNDFDDDDDILGSNESGTAEKPNSFAKTLTQS
DANNGGGFSVPRYCAETIFPRLDYTADPPVQTVTAKDVHGESWKFRHIYRGTPRRHLLTT
GWSSFVNQKKLVAGDSIVFLRAENGELCVGIRRAKRGGIGGPEAPSGWNSGAGNYGGFSA
FLREEMSKNGNLTSPTRSLRGKGRVRPESVVEAAYLASSGQPFEVVYYPRANTPEFCVRA
SSVNAAMRIQWCSGMRFKMAFETEDSSRISWFMGTISSIQLADPIRWPNSPWRLLQVAWD
EPDLLQNVKHVSPWLVELVSNMPVIHLSPFSPPRKKLRLPPDFSLDSQFQLPSFSGNPLR
SSSPFCCLSDNITAGIQGARHAQFGVPLLDLHLSNKLPSGLLPPSFQRVAANSQLPNVIN
KCQNDRNDNISCLLTMGTSSKTLDKNDSVNTPRFLLFGQPILTEQQISNGCSVSAPQVVQ
TGKDLGRIQPINEKHPSEQKGSIQDNLSSATFFWNRGYHAAELGVLNTGHCKVFLESEDV
GRTLDLSVMGSYEELYKRLANMFGLERPDMLTRVLYHDATGAVKHTGDEPFSDFVKSAKR
LTILMNSSSNIKRKWLTGLATAERGLDSSNQAGPLSIFA
Download sequence
Identical sequences K4DAA6
Solyc11g069500.1.1 Solyc11g069500.1.1 NP_001234796.2.44838 XP_010313187.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]