SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc12g042070.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g042070.1.1
Domain Number 1 Region: 124-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-40
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 700-774
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000589
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc12g042070.1.1
Sequence length 828
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch12 gene_region:42539933-42544628 transcript_region:SL2.40ch12:42539933..42544628- go_terms:GO:0005634,GO:0006355,GO:0046983 functional_description:"Auxin response factor 2 (AHRD V1 ***- Q2LAJ3_SOLLC); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence
MATSENCRNAAGAGKVDAEKALYTELWRACAGPLVTVPCEGELVFYFPQGHIEQVEASTN
QASDQQMPVYNLPSKILCRVINVLLKAEPDTDEVYAQVTLLPEPNQDENVVSKEPMPSPP
PRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHANEWRF
RHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNAPSSV
ISSHSMHLGVLATAWHAIQTKTLFTVYYKPRTSPADFIVPYDQYMESLKNNYSIGMRFKM
RFEGEEAPEQRFTGTIVGIENADLKRWPESKWRCLKVRWDETSAIPRPDRVSPWKVEPAL
SPPALNPLPIPRQKRPRSNVLPSSPDSSVLTREGSSKVVVDTSQASGFSRVLQGQEISTL
RGNFVENNESDSSEKPPIWQPLLDDEKADVHSASRKCISDKRLPLGRPESSFTDLLSGFG
GQSSSSHGFHSPTGGQTAPASWVKRQALDKETDFSLLAKQWSLVSSGLSLNLMESGLKGA
DTLYQMRGTSRLNCFNEYPTFPGHRPDNQQGNWLMPPSVLPYIQMSAHSGEIMPKPMASP
QPEAMKPKEGNCKLFGIPLVSKCATIDPVMLRKNSPIHSTSNMHFGIHPHQFPIIESDQR
SEQSKGSKLPDDGFIVHDQEEQFQTSHPGTRDREGKGLVHSTRSCTKVHKQGTALGRSVD
LAKFNNYEELIAELDHIFDFNGELKARNKNWLVVYTDDEGDMMLVGDDPWEFCGMVRKIF
IYTKDEVQRMNPGTLNSKGEDNSSVAEGSDAKEVKNLQLHIDSSPEDS
Download sequence
Identical sequences K4DF01
Sopim12g042070.0.1 Solyc12g042070.1.1 Solyc12g042070.1.1 XP_004252281.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]