SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc00g030210.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc00g030210.1.1
Domain Number 1 Region: 725-1054
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.62e-83
Family beta-Lactamase/D-ala carboxypeptidase 0.00035
Further Details:      
 
Domain Number 2 Region: 567-724
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.72e-39
Family Penicillin binding protein dimerisation domain 0.0012
Further Details:      
 
Domain Number 3 Region: 224-352
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 4.81e-36
Family Hypothetical protein MraZ 0.00066
Further Details:      
 
Domain Number 4 Region: 471-568
Classification Level Classification E-value
Superfamily Putative methyltransferase TM0872, insert domain 2.88e-27
Family Putative methyltransferase TM0872, insert domain 0.00025
Further Details:      
 
Domain Number 5 Region: 367-470
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.2e-19
Family MraW-like putative methyltransferases 0.0021
Further Details:      
 
Domain Number 6 Region: 2-132
Classification Level Classification E-value
Superfamily Ferritin-like 0.00000000000000141
Family Ferritin 0.054
Further Details:      
 
Domain Number 7 Region: 1092-1144
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 0.00000000458
Family MurE/MurF N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc00g030210.1.1
Sequence length 1147
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch00 gene_region:12587233-12591896 transcript_region:SL2.40ch00:12587233..12591896+ go_terms:GO:0009273,GO:0008658,GO:0008168,GO:0055114 functional_description:"Ribosomal RNA small subunit methyltransferase H (AHRD V1 *--- RSMH_RALME); contains Interpro domain(s) IPR001460 Penicillin-binding protein, transpeptidase "
Sequence
MRVNHVGEVCAQALYQAQKLTARSAQVRAQMDTAAQEEEDHLAWCAERLRELGSRPSLLN
PVWYAGAFAIGVLAGRAGDRVSLGFVAETERQVEHHLNGHLDRLPEADGRSRAILEQMRD
DEVRHGDAARAAGGVPLPGPVRALMRVASKVKAGVAISCPTRLSEDRAALSWRSAEIAAS
PRPAEAQSKTLYPSPRRGTDCRPRCRQYSLAGSQTSAVTGGTSLFQGASALSLDAKGRMS
IPARYREALQTQAEGRVTLTKHPDGCLLLFPRPEWEVFRGRIAALPMDAHWWKRIFLGNA
ADVDMDGAGRVLIAPELRSAALLDKEVMLLGMGSHFEVWDAATYAAKEQAAMVMTPTETP
GTTALRHRTVLLDEAVEALVWRPDGAYVDGTFGRGGHSRAVLARLGPAGSLVAFDKDPAA
IAEAGTIKDARFSIEHASFAEMGDRLRDRAPVAGVLLDLGISSPQIDEAARGFSFRFEGP
LDMRMDTTRGVTAAEWLAQADEHDIARVIRDYGEERFAVQIAKAIVARRRESGDGGPIAT
TSDLAALVAKTVKTREKGQDPATRTFQILDRNGLVLATSLPVKAIWAVPEDVPNDIEPQR
MRQLAKLLDLSEKDLRAKLNEDKSFVYLKRQVLPDAADKIAALKVEGIHQTREYKRFYPE
GEAMAHIVGFTNVEDKGQEGVELAREAGLAGRPGARQVIKDRLGRVVEDVGVLKTPRDGE
DMQLSIDAKIQYLAYNEVKAVVERNKAKAASAVVLDAQTGEVLALANWPTYNPNDRTRLS
GEQLRNRVLTDTFEPGSMMKPISIGLALQLGRVTPSTTVVTTGKYNFEGATISDTHNYGT
LTVGGVIQKSSNIGTTKIAMMMKPQEMWDMFTSVGLGQAPKIGFPGAVAGRVRPWKSWRP
IEQATMSYGYGLSVSLFQIAHAYTIFAHDGELIPVSIYKTNGPVTGERILSPTVAREVRG
MLETVTAPGGTAPEAQVMGYRVGGKTGTAYKHVGRGYDRSKYRASFIGLAPMSNPRVIVA
VSVDEPTAGSHYGGAVAGPVFSAITGGALRSLNVQPDSPIRQLMVTDKVPESEPWSASNA
LAWLHAHAPAGAKLTGDTRRLQPGDVFFAYVLGNERLATDGRPHIDKAIAAGASAVIYEA
EGFTWTX
Download sequence
Identical sequences Solyc00g030210.1.1 Solyc00g030210.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]