SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc00g104200.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc00g104200.1.1
Domain Number 1 Region: 292-359
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000000000209
Family KorB DNA-binding domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 208-301
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.000000000244
Family ParB-like nuclease domain 0.0049
Further Details:      
 
Weak hits

Sequence:  Solyc00g104200.1.1
Domain Number - Region: 2-135
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000451
Family G proteins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc00g104200.1.1
Sequence length 402
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch00 gene_region:15895483-15896729 transcript_region:SL2.40ch00:15895483..15896729+ go_terms:GO:0003677 functional_description:"Nucleoid occlusion protein (AHRD V1 *--- NOC_BACLD); contains Interpro domain(s) IPR004437 ParB-like partition protein "
Sequence
MGFLGLNVMAAATGMLIPVPARQLDYLSTIHFMDTIAENIEILEDHGTPVDYGFIRVVCS
AYTPSKPGEADMWKMMKATYANFLLNQPILASEEIKNATQAFRSIYESKPSAAHATYQRC
RDNLNAVFGEVLNEIHEQWECCSVSRRSLIGEALASPAPDQPSVSEAKDAAGATASRNFT
TRRLEGFTEAARMVKRPTIRLKPAECSIWPGNARDYEQLTEPRLRSLIESIQAENGNRIP
VVVRRKQQGELQYELIIGTRRHWAVAWLNANHYPDIELVAIIEDLDDEAAFRLADIENRE
REDISDLERGLNYKAAVDTYYDGLQARLAERVKISKSTLARYIGLTEIPQTIVSAFASPM
ELQVRYGDKLLPAIRNPSLRPRMEEAAKQIAAEQSFRQSGXX
Download sequence
Identical sequences Solyc00g104200.1.1 Sopim00g104200.0.1 Solyc00g104200.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]