SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g050200.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g050200.1.1
Domain Number 1 Region: 605-733
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.68e-38
Family Single strand DNA-binding domain, SSB 0.00016
Further Details:      
 
Domain Number 2 Region: 438-604
Classification Level Classification E-value
Superfamily BRCA2 helical domain 5.75e-37
Family BRCA2 helical domain 0.00055
Further Details:      
 
Weak hits

Sequence:  Solyc02g050200.1.1
Domain Number - Region: 737-767
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00377
Family Single strand DNA-binding domain, SSB 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g050200.1.1
Sequence length 792
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch02 gene_region:24769173-24773290 transcript_region:SL2.40ch02:24769173..24773290+ go_terms:GO:0005515 functional_description:"Breast cancer susceptibility protein 2b (AHRD V1 ***- Q7Y1C4_ARATH); contains Interpro domain(s) IPR015187 BRCA2, oligonucleotide/oligosaccharide-binding 1 "
Sequence
MSMWQLYSVSVNDFRWKVSGESLTEEPSLTLPPQQLQSIPDLLRQGTSRLAGNTDSTSTR
FPIFRGKPVSVKHSSISTALSILDDEDKPILDTGIGTGRQDVLTFQEAVFQKGSGEPLNA
PQSFSPSSLNKQFSMSNSLFQTASGKPVNISCTGLNKAKALLGLEENGDHETFPGSGKKN
TTPDELFGFRNSFPIVEVEGIASTGSTNVSAASLSPFDVKFNSTVCPAEELVADFLHSAG
KPPPIKFHTAGGRSITVSCEALKRAKSLLGDLELGCLVDEKDMADPLLSFSKDQKSVDQV
STKELNSDTPVSLLSAAKGSGSSSLFTSPLRSTLYHKKSSIKLENLVPASNLIKEFDAVA
KESTSRLDHSIPQNGEPFNKNSAATDLRENDIASKPKLLERPSRGPLVDISNNIGGGIAD
RNQNVGRKRKPGGSFVSPFKKPRSTSIVNPLKRNDSGAANGFSDLAPKLPSQKGKVSIRY
PFHVARLYMKEYLGKPPSILSKLESLPDDVSRMNPATAETYVFNDESCSGCIGVGSFLEM
LSQSGASMQYVSKKWITNHYKWIVWKLASYERCYSGKFSGKLLTICNVLEELKYRYEREV
NHGHRSAVKRILEGDLPPSSMMVLCVSNIYSIHVSPVGPQSSLSSTTENGTCAKVELTDG
WYSIIAVLDLQLSKKMAAGKLFVGQKLRIWGAGLCGWTGPVSPLEVSGTTSLLLHINGTY
RAHWASRLGFCKGGGIPLSFMSIKDGGGAVPLTLVVISRIYPVLFRERLSNRGFVVRSER
MEVKEMQNFNER
Download sequence
Identical sequences K4B609
Solyc02g050200.1.1 Sopim02g050200.0.1 Solyc02g050200.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]