SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g072260.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc02g072260.2.1
Domain Number - Region: 226-257
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000286
Family Rho termination factor, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g072260.2.1
Sequence length 262
Comment genomic_reference:SL2.40ch02 gene_region:36137372-36139809 transcript_region:SL2.40ch02:36137372..36139809+ go_terms:GO:0006353 functional_description:"H2B histone-fold-like protein (Fragment) (AHRD V1 ***- A7VMP7_TOBAC); contains Interpro domain(s) IPR011112 Rho termination factor, N-terminal "
Sequence
MGATATAVFSSNSISQLPSFSALCKPNLGIRIPKGVLFNLAEITYGLSLSTNRRDFHCST
LSTIRADGIRRRKSSKDATPGKTSKGSELNIQPSPDSKLPNSLNQEEIISLFKRIQSSIS
KGDSTSSKKRSTKSSEERPAIDSVLEILRHSKTEAKGTKDDKGSTHQEDQKEPETDYSPT
ADPRSTRLRSSFVKRSPLQSPFNSKEKVKLKMETSLENHVESEAVKIEEMKLPQLKELAK
SRGLKGYSKLKKSELVELLIGC
Download sequence
Identical sequences K4B8K0
Sopim02g072260.0.1 Solyc02g072260.2.1 Solyc02g072260.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]