SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g111410.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g111410.2.1
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-19
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 269-335
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000412
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g111410.2.1
Sequence length 343
Comment genomic_reference:SL2.40ch03 gene_region:56052504-56063403 transcript_region:SL2.40ch03:56052504..56063403- go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os01g0905400 (AHRD V1 *-*- Y1054_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MESANVACDKCKKDCLLIHRKRVPSFYKAMTDKSCFQVLIVPPNFARSASHLVDKVTLVK
DASGLRWPVTVCDYQGLLAIQQGWPEFASKHDLVVGDHLVFHYTQRQHFTVQIFDMNGYE
KIIFCCDTDKGEKRAATRVEETTRAGDAQFDQDGRLCLHQSRFEMPASKPPAEGLLPLRE
DGIKATGMVSRPAEDILLLGPKDKKCKKASQFDSGEEEANGNGKVNKSESAGLGDTPSFP
ANNYSSLVEIYGPDFLELPGSWRDLLQRPTRERWIIFLRGPDKRIWPTYYTSLLPPYYSR
RPSVDVLSRGWKEVAAAYGMNAKDHCLFELADKQNRIFDIRKI
Download sequence
Identical sequences K4BK04
Solyc03g111410.2.1 Solyc03g111410.2.1 XP_010319048.1.44838 Sopim03g111410.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]