SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc04g016290.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g016290.2.1
Domain Number 1 Region: 560-602
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000589
Family Rho termination factor, N-terminal domain 0.035
Further Details:      
 
Weak hits

Sequence:  Solyc04g016290.2.1
Domain Number - Region: 12-86
Classification Level Classification E-value
Superfamily TerB-like 0.0115
Family COG3793-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc04g016290.2.1
Sequence length 606
Comment genomic_reference:SL2.40ch04 gene_region:7074883-7078461 transcript_region:SL2.40ch04:7074883..7078461+ go_terms:GO:0006353 functional_description:"Unknown Protein (AHRD V1); contains Interpro domain(s) IPR011112 Rho termination factor, N-terminal "
Sequence
MDLFIWGPPYFQDENSFPTNSLAQNFYFSQRLDIIEEDALNEKCCVQVLEILIAKADTEI
AKIEDDIVMLQSQLARIDEKWLDMCIATLNKKIDRLGSLITALKIKNVQASGVHLKTNKR
PSERTHEILETPPRNFSSPVDKQTANSTLGSSKLAASVLIEVEATDNHNLKDFETVETNG
ESTVQANVMIQTLSVVQERNLQVKDENVITKGSCTKAFGHASDKSTLKDLNESDIPGKLI
NASKREKPSQLNNFACAVFKSANTKSLRDKAEFYGESKRKIDEVMQQSSNDSIIMKSSLG
VKQTSIGEGPKTAGAIMVTRLSAVKQEPKESGDEQAQNGTKAGQTREKHTSSQLVTQKQT
GAKQIPGIKRGLLMLNPIKKDRNKQLEKFKGELQVKQSPKSQVLTIHKSKSIFSPKLEGQ
RPKLKCNVPTEMPKEPCLAEELGFKSPSGLKLKRQLKTGSTKENGGDEFKDKTTKESLSP
LGGAKETGDLPEISSTSLIHLKKRRITSSTGPILQENENLRDFQNRLVKSYDRSNQNRQV
IKVENDKLLDSPTFTAPIPDITDLKYMTMNQLRAVAKHHNVHGVYKFRKSELQEHLRKLL
TKGRST
Download sequence
Identical sequences K4BQC9
XP_010319168.1.44838 Solyc04g016290.2.1 Solyc04g016290.2.1 Sopim04g016290.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]