SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc01g081050.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g081050.2.1
Domain Number 1 Region: 151-649
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.45e-91
Family Acetyl-CoA synthetase-like 0.00000244
Further Details:      
 
Domain Number 2 Region: 814-1202
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.67e-34
Family Quinoprotein alcohol dehydrogenase-like 0.0087
Further Details:      
 
Domain Number 3 Region: 649-694
Classification Level Classification E-value
Superfamily ACP-like 0.0000288
Family Peptidyl carrier domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g081050.2.1
Sequence length 1206
Comment genomic_reference:SL2.40ch01 gene_region:72868817-72892330 transcript_region:SL2.40ch01:72868817..72892330+ go_terms:GO:0008152 functional_description:"D-alanine--poly(phosphoribitol) ligase subunit 1 (AHRD V1 *--- DLTA_BACSU); contains Interpro domain(s) IPR000873 AMP-dependent synthetase and ligase "
Sequence
MVLHKKLSTCCISHEFYKVATNNPNKIAVIQACGGLKIAKEFRLSCSENGDQDNREKFQE
FVSSKMKSVNPPIYEGDQCFTFSEILSAVDSLSSRLRCILDGGDDPNLINSSAVNIHQTA
NDCSSKDQLLLGSSDRGLEQYTQFHKTYIPRVVGIYMEPSVEYIVSVLSVLRCGEAFMPL
DPSWPNERILSVISSSKADLIVGYKSSVDRPCHQLDKLRWLIHKGSYPLFYMSIENVMRK
KSDSSLAWPCESERLRSFCYLMYTSGSTGIPKGVCGTEVGLLNRFLWMQGSFPFQKEEIL
LFKTSISFIDHLQEFLGAILANCTLIIPPFNQLKDNIFLVVNLSQEYSISRLVAVPSFIR
AILPALHSMHYPTAQISLKLLVLSGEIFDISLWKMLVKLLPETTVLNIYGSTEVSGDCTY
FDCKWLPTMLEQDALDSVPIGIPIDNCEVVLIGENSLDEGEICVSGSCVASGYFIHPSIL
SLDNVELHQEITDGKKDENEVYFRTGDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVE
SILREHQEVADSAVVSRCVQGDILFLEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIP
ARFYFVESFPRSSSGKVDYKMLATFAASEAGNRIAIEETQDIDLVNVIQKISLDDDFFEI
GGNSLLAAHVSYNLGINMKDLYAFPTPLKLQKAIQLKKVSSSRELRADALVGVNSQEQEK
SKLPSNKSWMPGADNSTALSLTSDYPVKRLKTDSDLYIDSNDANGRDMNNSTSSQVSCSY
SRCNKIRHDAGCEGYNCHSMLSWEVPRDKRGFMREQWMVNMESCVDASPLVVFKERSVYL
LIGAHSHKFYCIDATSGLVLWEIKLQGRVESSAAILDDFSQVIVGCYDGNIYFLNFSNGI
PCWNFQTHGEVKSQPVIDKKRHLVCLLHIYPLFHLLEGGIGGKTIKYRKRMRIHIRCGSH
DHNLYALDYENHCCAYKIQCGGSIFGSPALDEVQEKLYVASTSGRVTALFVGAPPFGQLW
VQEFGVPIFGSLSVNPPSGNVICCMVDGNVVALDTEGSVVWKVSTTGPIFAGPCISHALS
LQVLVCSRDGSVYSFDLEKGDLFWKHDVGHPITSSAYVDEHLLLACPDSSLSQRLVCVCS
SSGSVHVLQVSLNFDGENQPCDMVREFARFELGGDVFSSPVMIGGDIFVGCRDDYMHCIR
LQEIPI
Download sequence
Identical sequences K4AXZ7
Solyc01g081050.2.1 Sopim01g081050.0.1 Solyc01g081050.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]