SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc02g069310.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g069310.2.1
Domain Number 1 Region: 267-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000126
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 51-190
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000133
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g069310.2.1
Sequence length 581
Comment genomic_reference:SL2.40ch02 gene_region:33817760-33823152 transcript_region:SL2.40ch02:33817760..33823152+ go_terms:GO:0005515 functional_description:"NPR1-2 protein (Fragment) (AHRD V1 ***- B8XQT6_SOYBN); contains Interpro domain(s) IPR013069 BTB/POZ "
Sequence
MASSAEPSSSISFTSTSNTSNGSIGIGQNTCACGGSETGSSYEIISLSKLSNNLEQLLLD
SSSEFSDAEIVVEGVSLGVHRCILAARSSFFRDLFRKRNGNCGKEGKPSYSMIDILPCGK
VGYEAFLTFLSYLYSGKLKHFPPEASTCVNSLCSHDSCRPAINFHVELMYASFVFQVPEL
VSLFLRHLFSFVGKALVEDVIPILGVAFHCQMSELLTHCVDRVARSDLESTCIEKEVPFK
VAESIKLSRLKCQGDESMVLTVDPLHEKRKNRIYKALDSDDVELVKLLLNESDISLDGAY
ALHYAVAYCDPKVVAEVLGLGVANVNLRNARGYTVLHIAAMRKEPSIIVSLLTKGAHASE
ITLDGQSAVSLCRRLTRPKEYHAKTEQGQEANKDRVCIDVLEREMRRNPMTGDALFSSPM
LADDLPMKLLYLENRVAFARLLFPLEAKLAMEIATAETTAEFADHLASKASSGILREVDL
NETPIMQKERLSKTVELGKCYFPHCSEVLDKFMEDDLPDLFFLEKGTPEEQKIKRRRFKE
LKDDVQRAFNKDKAGLHRSGSSSSSSSTTFNDGASVKARNL
Download sequence
Identical sequences Q6GUF2
NP_001234562.1.44838 Solyc02g069310.2.1 Solyc02g069310.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]