SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g010240.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g010240.2.1
Domain Number 1 Region: 219-410
Classification Level Classification E-value
Superfamily GroEL apical domain-like 6.28e-68
Family GroEL-like chaperone, apical domain 0.00000948
Further Details:      
 
Domain Number 2 Region: 45-169,440-538
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 5.41e-55
Family GroEL chaperone, ATPase domain 0.00054
Further Details:      
 
Domain Number 3 Region: 176-239
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 5.26e-17
Family GroEL-like chaperone, intermediate domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc05g010240.2.1
Sequence length 541
Comment genomic_reference:SL2.40ch05 gene_region:4417123-4420793 transcript_region:SL2.40ch05:4417123..4420793+ go_terms:GO:0042623 functional_description:"chaperonin (AHRD V1 ***- B2IXD2_NOSP7); contains Interpro domain(s) IPR001844 Chaperonin Cpn60 "
Sequence
MSCSLNHLPAITLKNGSVNRISKRVSCSMLNTRAMAKELYFNHDGSTTKKLLAGVDLVAE
LVGVTLGPKGRNVVLGNKYGPPKIVNDGETVLKEIQLDDPLEYVGVKLVREAGAKTNNLA
GDGCTTSIVLARGLIAEGVKVTAMGANVVQVSRGIEKTAKALISELKLMSREVEDHELED
VAAVSAGNDYAIGNMISEALRQVGREGVVTIEKGNSTKTNLEVVEGMQFDRGYLSPYFVT
DRRKRIAELHDCKLLLVDKKISNPKELVKILDNAVKEKYPVLIIAEGIEQDALAPVIRNK
LRGVLKVAAIKAPSFGERKSHYLDDIAILTGGTVIRDDIGLTLENAHKDLLGSASKVVIT
KDSTLIVTDGNTQTAVSKRVSQIQNLVENTEEKFQKKILNERIARLSGGIAVIQVGAQTQ
VELKDKQLRIEDALNAARAASEEGVVVGGGCCLLRLSSKVDAIKETLDNEDQKIGADIFK
RALSYPAKQIAKNAGVNGSIVVEKILSVDDMKYGYNAARDRYEDLMAAKILDPTKARYYI
S
Download sequence
Identical sequences K4BXJ7
Solyc05g010240.2.1 Solyc05g010240.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]