SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc05g056310.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g056310.2.1
Domain Number 1 Region: 13-142,405-525
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.4e-86
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00015
Further Details:      
 
Domain Number 2 Region: 210-378
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.06e-49
Family Group II chaperonin (CCT, TRIC), apical domain 0.0000004
Further Details:      
 
Domain Number 3 Region: 142-214,369-403
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.69e-25
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc05g056310.2.1
Sequence length 557
Comment genomic_reference:SL2.40ch05 gene_region:64792047-64799309 transcript_region:SL2.40ch05:64792047..64799309+ go_terms:GO:0051082 functional_description:"T-complex protein 1 subunit gamma (AHRD V1 ***- B6UCD0_MAIZE); contains Interpro domain(s) IPR012719 T-complex protein 1, gamma subunit "
Sequence
MHAPVLVMQDSMKREQGGKVQRANIQAAKAVADIIRTTLGPRSMLKMLLDAAGGIVVTND
GNAILRELDLAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEMLHVAEAFIDKKYHPTVI
CRAYAKALEDAVAVLDKIAMTVDVEDRETMLGLVKSCIGTKFTSQFGDLISDLAIDATRM
VGVELGQGLREVDIKKYIKIEKVPGGQLEDSVVLKGVMMNKDVVAPGKMKRKIVNPRIIL
LDCPLEYKKGENQTNAELLREEDWTVLLKMEEEYIENMCAQILKFKPDVVITEKGLSDLA
CHYLCKAGVSAIRRLRKTDNNRIAKACGAVIVNRPDELQESDVGTGAGLFEVKKIGDEFF
TFIVDCKDPKACTILLRGASKDLLNEVERNLQDAMSVARNIIKCPKLVPGGGATELTVSA
MLKQKSSSVEGIEKWPYEAAAIAFEAIPRTLAQNCGVNVIRTMTALQGKHANGENAWIGI
DGNTGEITDMKERKIWDSYAVKAQAFKTAIEAACLLLRIDDIVSGIKKKQAPGAGQGPSK
PKIDEEGDADNDQLIPE
Download sequence
Identical sequences K4C2V5
Sopim05g056310.0.1 XP_004239648.1.44838 Solyc05g056310.2.1 Solyc05g056310.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]