SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc06g076790.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc06g076790.1.1
Domain Number 1 Region: 30-106
Classification Level Classification E-value
Superfamily TSP9-like 6.67e-22
Family TSP9-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc06g076790.1.1
Sequence length 106
Comment evidence_code:10F1H0E1IEG genomic_reference:SL2.40ch06 gene_region:44091817-44092137 transcript_region:SL2.40ch06:44091817..44092137- functional_description:"Unknown Protein (AHRD V1)"
Sequence
MASLNMFVSPIATVTAQQHRSRVYTAATASKSSGGSTEEKSLLDFILGALQKQDQLLETD
PLLKKVEDKSVSTTSSGRKNSVAVPPKKNSNGGGFAGFGGLFNKKD
Download sequence
Identical sequences K4CA37
Solyc06g076790.1.1 Sopim06g076790.0.1 Solyc06g076790.1.1 XP_004241176.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]