SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc07g017470.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g017470.1.1
Domain Number 1 Region: 13-73
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000165
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc07g017470.1.1
Sequence length 96
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch07 gene_region:7243989-7244279 transcript_region:SL2.40ch07:7243989..7244279+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os04g0386900 (AHRD V1 ***- Y4869_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence
MSKELPFDGAPAVLSYGGKKWNLIYGGAKTKYKFSTGWKNFADDNNLKEGDGLVFELSEC
NSDKIEFKIQILREDFPAELVPDVEGMNTNNPIIID
Download sequence
Identical sequences K4CCG2
Solyc07g017470.1.1 Solyc07g017470.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]