SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Solyc07g040690.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc07g040690.2.1
Domain Number 1 Region: 246-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.24e-17
Family Ankyrin repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 54-176
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000115
Family BTB/POZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc07g040690.2.1
Sequence length 576
Comment genomic_reference:SL2.40ch07 gene_region:46706989-46722544 transcript_region:SL2.40ch07:46706989..46722544- go_terms:GO:0005515,GO:0016563 functional_description:"NPR1 protein (Fragment) (AHRD V1 ***- A8KRW4_CAPCH); contains Interpro domain(s) IPR002110 Ankyrin "
Sequence
MDSRTAFSDSNDISGSSSICCMNESETSLADVNSLKRLSETLESIFDASAPDFDFFADAK
LLAPGGKEIPVHRCILSARSPFFKNVFCGKDSNTKLELKELMKEYEVSFDAVVSVLAYLY
SGKVRPASKDVCVCVDNECLHVACRPAVAFMVQVLYASFTFQISQLVDKFQRHLLDILDK
AVADDVMMVLSVANICGKACERLLSRCIDIIVKSNVDIITLDKSLPHDIVKQITDSRAEL
GLQGPESNGFPDKHVKRIHRALDSDDVELLRMLLKEGHTTLDDAYALHYAVAYCDAKTTA
ELLDLSLADVNHQNPRGHTVLHVAAMRKEPKIIVSLLTKGARPSDLTSDGKKALQIAKRL
TRLVDFTKSTEEGKSAPKDRLCIEILEQAERRDPLLGEASLSLAMAGDDLRMKLLYLENR
VGLAKLLFPMEAKVAMDIAQVDGTSELPLASMRKKIADAQRTTVDLNEAPFKMKEEHLNR
LRALSRTVELGKRFFPRCSEVLNKIMDADDLSEIAYMGNDTVEERQLKKQRYMELQEILS
KAFTEDKEEFAKTNMSSSCSSTSKGVDKPNNLPFRK
Download sequence
Identical sequences K4CDU6
Solyc07g040690.2.1 NP_001234558.2.44838 Solyc07g040690.2.1 Sopim07g040690.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]