SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CGD0017630 from Theobroma cacao Matina 1-6 v0.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CGD0017630
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.61e-21
Family B3 DNA binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CGD0017630
Sequence length 213
Comment aalen=213,62% Dbxref=vitis:XP_002275489.1,populus:POPTR_0001s32990.1
Sequence
MLPFCLVAYHCLIDVIDPKKLRFLFQKELKNSDVSSLRRMILPKRAAEAHLPVLESKEGI
LISMDDLDGLHVWSFKYRFWPNNNSRMYVLENTGEFVNTHGLQLGDFIMVYQDSQNQNYV
IQAKKASDQDVYADIARNAVNDLFLHDYEVSKSSSYYYPTMDDTGMSFIYDTTFSNDSPL
DFLGGSMTNYSRIGSLESFGSVENLSLDEFYQV
Download sequence
Identical sequences CGD0017630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]