SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CGD0005431 from Theobroma cacao Matina 1-6 v0.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CGD0005431
Domain Number 1 Region: 8-86,208-244,279-474
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.13e-67
Family IF2B-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CGD0005431
Sequence length 489
Comment aalen=489,64% Dbxref=vitis:XP_002272876.1,arabidopsis:NP_001118597.1
Sequence
MPDTQALVNDFLNQLKKRKIEGSQATAKQTAELLRSVISQTRVPYTNQAGALIDSVKAVG
ERLIAANPVGMKFDDYAMLLMRKLLAYIDTVSVVYAQTRTQCMDVMAELAVGNIVRRVLH
IIREEDVSLTTAAMAGLNLSAVSDDEDDADRDDRPVLSAAAVAAASRSTLRPPSLQTLLE
DVPDSAAVPHTSSSGGDSEGKSKSADKSSRSRKLKHDVIEAVNELIQDINTCHEQIAEQA
VEHIHQKGEHRAVWLASVVGEATTDQADRGGGTDRAKGEANQIVTNHGSSRTVLEFLCAA
KEKKRSFRVFVAEGAPRYQGHLLAKELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVM
ANGGVIAPVGLNMVALAAQKHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGE
FSDCMDFGSGNGAPLLHVVNPTFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLV
VQRRPTSGN
Download sequence
Identical sequences CGD0005431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]