SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CGD0007801 from Theobroma cacao Matina 1-6 v0.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CGD0007801
Domain Number 1 Region: 313-635
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.47e-89
Family IF2B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CGD0007801
Sequence length 642
Comment aalen=642,65% Dbxref=vitis:XP_002283177.1,arabidopsis:NP_175327.3
Sequence
MDARRVTRAVPRVRQVGFFTPNAPPEQPGPVRSQSGPPNSNSPPLSGSPASNSLSPVMIP
PPRHLSDNLGARTGAVPVPGRANAGDHATVGSYNPADSVLGLESPPPTRIGDGESSEETE
SSLGWYRRNNPAKFASSFPGGGFDLSPVKQPEIVSGVEAKNQPPEKNEVQKGQASSSKPS
KAKTTKAERRALQESQRAAKAASKAEANKSGGGAASSKTVKQPSQKKDAPPVASSVATSE
RIGVDRPAEKERKKDVPPPRMQFDDESRVGKAKRRSVLNQPEARNSIELFRHLPPHKNGT
QLPYLESKFFELHDKHPAVYKVGLQYLTGDLSGGNARCIAMLQAFQEAIRDYSTPPEKTL
IRDLTSKIGGFVSFLIECRPLSMSMGNAIRFLKSRIAKLPPILSESEAKAALCSDIDRFI
NEKIVLADKVIVRHAATKIRDGDVLLTYGSSCVVEMILLYAHELGKQFRVVVVDSRPMLE
GEKLLRRLVAKGLSCTYTHLNAISYIMHEVTRVLLGASSILSNGTVYSRVGTASVAMVAY
AYRVPVLICCEAYKFHERVQLDSICFNELGDPDAIAKVPGRVDVNYLDNLSDKQKENLKL
LNLKYDATPSDYISMIVTDYGMIPPTSVPVIVREYRKEYLLI
Download sequence
Identical sequences A0A061FUI7
CGD0007801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]