SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CGD0031382 from Theobroma cacao Matina 1-6 v0.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CGD0031382
Domain Number 1 Region: 58-405
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.76e-115
Family IF2B-like 0.0000000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CGD0031382
Sequence length 424
Comment aalen=424,62% Dbxref=vitis:XP_002277806.1,arabidopsis:NP_027726.1
Sequence
MCHSRGAAARNENTVTAESSKGGAPFHSFHKPQKYLAFSKTQSMAPDYKSSDGLVVDNTL
QSICYKCGSLQLLDQRKLPLETVYLDIQDATDGWNAIRDMVVRGAPAIAIAAALSLAVEV
ANLKDFNGTCEDAASFLEMKLEYLVSSRPTAVNLSDAATKLRKIISKAATTATVPGNVFQ
AYIEAAEVMLEDDVASNKAIGSYGASFLQHQQKNSKRFSVLTHCNTGSLATAGYGTALGV
IRALHAEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRVSAVI
VGADRVAANGDTANKIGTYSLAICAMYHHIPFYVAAPLTSIDLSLSSGQEIIIEERSAKE
LLHTRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVITKNTDAFDIKNFMEKATG
KSTV
Download sequence
Identical sequences A0A061GM77
CGD0031382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]