SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390940664|ref|YP_006404401.1| from Sulfurospirillum barnesii SES-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390940664|ref|YP_006404401.1|
Domain Number 1 Region: 2-377
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.29e-96
Family Homocysteine S-methyltransferase 0.00000721
Further Details:      
 
Domain Number 2 Region: 335-599
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.7e-72
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00053
Further Details:      
 
Domain Number 3 Region: 874-1156
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 6.15e-72
Family Methionine synthase SAM-binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 711-839
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 6.15e-38
Family Cobalamin (vitamin B12)-binding domain 0.00013
Further Details:      
 
Domain Number 5 Region: 626-708
Classification Level Classification E-value
Superfamily Methionine synthase domain 5.89e-20
Family Methionine synthase domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390940664|ref|YP_006404401.1|
Sequence length 1156
Comment methionine synthase [Sulfurospirillum barnesii SES-3]
Sequence
MSTLHTLIKEKILVIDGAMGTQIQALHITPEQWAGKEGCNELLNLTCKDEISKIHRGYLL
AGADIIKTNTFGALPWVLEDYGIGEQTYELARAGVAIVKEACLAFSTEHKPRFCAAAFGP
GTKLPSLGHIGYDEMYEGYTVAARGAIDGGCDLFLIETAQDPLQIKAALHAISDAQKYLH
VKLPVMVSVTIELSGSMLIGTDASTIAAILEPFELLSLGFNCGTGPEQVEKHVKTLSSVW
DRPISVHANAGLPQNRGGYTFYPMGPREFAELQEKFTEIAGVSILGGCCGTTPQHILELS
KKVEGKKPLAPVGSMPRSIASLFETRSLKQDPAPFLIGERSNATGSKAFRELLLAEDYDG
TLSVAQQQVRSGAHGIDVSVGFAGRDEEKDTKEVIGRYAQKIALPLMVDTTQVKSLDVAL
KMVGGRAIINSVNLEDGMEKFDKVCSLAKRFGCALVCLTIDEQGMAKSKAEKVAIAERIF
QLATKNHGLNPGDLVFDLLTFTVGSGDAEYHTAAIETIEAIREFHAMHPEVGFVLGISNI
SFGLAKHAREYLNSVFLHHCVEAGLSMAIVNVKNTLPMHKISDVDKKVCEDLLFNRREEG
DPLFKFISHFEGVVENKDESDAAYLAMSTKEKLSTLLIDGDKERMLALLPTAKEEIAAEI
IVNEILIDAMKVVGELFGSGKMQLPFVLQSAEVMKASVDYLQPFLPKSEKSTTTTLIIGT
VKGDVHDVGKNLVDIILSNNGFKVINIGIKADLEQFLEALKEHKADAIGMSGLLVKSTNV
MKENLEAMQKMGINIPVILGGAALTDNFVEDFCRPIYEGPIFYCKDAFEGITAMSRIEAK
DFNTDFGRKVLENAVMKASKETKEIPPFHELKMPSREVKIPTPPFWGRRVLKTDVKELAY
SWINHKILFSQRWGYSGKGQSKEEKQKQLDEVLYPTYERVRADIERLGLFEPTIIYGYYP
ARSFENTLYLFDESEGYFSEEQVCRESIDVVEKRAMKTFDFPRQNRAPYRSLSDFIHPER
HDVLALTCVSAGAKFSAYEKELYDAGNFTEYFFVHGLGVELAEALAEIVHKQIRLDLGIA
EQEGHSLRDVQMKRYNGCRYSFGYPACPALEDTKVIFELLKPEEFGIELSETFQIHPEQS
TTAIVMHHKEALYFNV
Download sequence
Identical sequences I3XY02
WP_014769704.1.31631 gi|390940664|ref|YP_006404401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]