SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62390082|ref|YP_225484.1| from Corynebacterium glutamicum ATCC 13032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62390082|ref|YP_225484.1|
Domain Number 1 Region: 212-352
Classification Level Classification E-value
Superfamily CBS-domain pair 3.03e-26
Family CBS-domain pair 0.003
Further Details:      
 
Domain Number 2 Region: 356-460
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.18e-17
Family CorC/HlyC domain-like 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62390082|ref|YP_225484.1|
Sequence length 467
Comment CBS domain-containing protein [Corynebacterium glutamicum ATCC 13032]
Sequence
MLTAVLSLIAGLVVIGVIIVLNGYFVAQEFAYMSVDRNELRALADSGDKKARRALSITKR
TSFMLSGAQLGITVTGLLVGFVAEPLVGNALGVLLGGVGVPAAVSISVGTVLALAISTVV
QMIFGELFPKNYTLATPLKSALALAPSTTWYLKLAGWLITFFDFASNALLRLFRIEPVED
VDSSATAQDLPHIVASSRDSGVLNNSMSLSLDRLLDFPSHDVGHAMIPRSRVGVVDPETT
IAEVKALMRKAHTRYPIIDDNHVPIGVINLIDILGTDIHGAEISDSAKVTEFMHQPVIVP
EFMSLPDVVTELHNREDRLACVIDEYGGFIGIVTLEDLAEEVLGDINDEHDVFSSEDITE
TSPDKWLIDGDTPLDEVERAIGYELPEGDYETISGLLFDHANALLKTGDVIEIPLDFEPE
DYLNNTSPTQRILRITVLEVERNVPVKLALALLEDHPDNHPAPKENR
Download sequence
Identical sequences A0A2H5HXG5 Q8NR63
196627.cg1349 NP_600420.1.3765 WP_011014192.1.21641 WP_011014192.1.3871 WP_011014192.1.4395 WP_011014192.1.80527 gi|62390082|ref|YP_225484.1| gi|62390082|ref|YP_225484.1| gi|62390082|ref|YP_225484.1| gi|530315355|ref|YP_008401319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]