SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPW00000027792 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EPrPW00000027792
Domain Number - Region: 21-92
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00863
Family HPr kinase/phoshatase HprK N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000027792
Sequence length 157
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_8195:31:504:1 gene:maker-piw_contig_8195-snap-gene-0.0 transcript:EPrPWT00000027792 description:"Pogo transposable element with KRAB domain (LST003/SLTP003).."
Sequence
NDLHRCGFGRRTWRDILHAPASSHLQIYGNTKGWWNERLSLEFLKHHFGGRSASDPPVIL
LWDDMSAHWTKDVMEYAASQRVELLRVPPRFTFCCQPADVAWNKPLKDRLRAKWISELRV
RISNNDKVVAPRRSDVMEWLVEAWSALSSQTIVNGFR
Download sequence
Identical sequences EPrPW00000027792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]