SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPW00000016717 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000016717
Domain Number 1 Region: 235-435
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.02e-83
Family N-myristoyl transferase, NMT 0.000000611
Further Details:      
 
Domain Number 2 Region: 52-234
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.85e-74
Family N-myristoyl transferase, NMT 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000016717
Sequence length 436
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_347:1822:3132:1 gene:maker-piw_contig_347-fgenesh-gene-0.0 transcript:EPrPWT00000016717 description:"Glycylpeptide N-tetradecanoyltransferase."
Sequence
MSSPVKDAVAGKPELITVEEQEEFLRVIKQLNLASAPQAAAALEKQLGTDEKDFKFWKTQ
PVPKIDEFPQEHGAIDAPKTVDDVRKEPYAMPAGFAWSEIDLAQSEQAQEVYDLLTHNYV
EDDDNMFRFDYSIEFLKWALTPPGYHKEWHIAVRNEKTSKLMAFISAIPVKTRVYEHTME
MAEVNFLCVHKKLRTKRLAPVLIKEVTRKVNLKNIWQAVYTAGVMLPMPVAQCRYFHRSL
NPKKLIDVGFSQLPPRMTMTRTIKMYKLPENPATPGFRQMLKKDVAQVTALLKTYLSKFD
LVPHYDQRELAHWMLPRDGVISSYVVENPKTLKVTDFCSFYHLPSTIIGNTKHKTLNAAY
SFYNVATSVTLTELMQDALVMAKKTDFDVFNALTLMDNSEFLEELKFGAGDGDLMYYLYN
WRCPRMSGERVGTVLC
Download sequence
Identical sequences EPrPW00000016717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]