SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPW00000023108 from Pythium iwayamai DAOM BR242034 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPW00000023108
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.23e-36
Family Nitrogenase iron protein-like 0.01
Further Details:      
 
Domain Number 2 Region: 221-334
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.000000129
Family DRTGG domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPW00000023108
Sequence length 339
Comment pep:novel supercontig:GCA_000387465.2:piw_scaffold_1989:2040:3379:-1 gene:maker-piw_contig_1989-fgenesh-gene-0.2 transcript:EPrPWT00000023108 description:"Cobyrinic acid a,c-diamide synthase family protein."
Sequence
MATKHLLVLSTGQHVGKTTVSLGLVKSLQAQYRGSGRQVAYCKPVGQQHVPVGGGLRVDK
DAFLFKEHFGLVHDYRDMSPVIFPDGFTRDFIDGKVTEAELAAAIERAHANLYRESDFLI
CEGTGHTGVGSICELNNAQVAAKLNMDVVCVALGGLGSSFDQLAMNRELLVKHNVRMRGV
ILNKVNPQKMDMIKDYFSRALKRWDIPLVGCIPELKDLSCPTMADYSKLLKSPMISGDEA
DMRYFTSIRLALAPVNEKNLFKAIPNQLVITHSGRHDVIDAILGNQEASMPQNLMSGLIL
TGWEPPSDALAKRLEADGIPCIYVSPAEADSYTLTARIA
Download sequence
Identical sequences EPrPW00000023108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]