SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606157|ref|YP_255027.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606157|ref|YP_255027.1|
Domain Number 1 Region: 4-251
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.11e-73
Family FdhD/NarQ 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70606157|ref|YP_255027.1|
Sequence length 253
Comment formate dehydrogenase [Sulfolobus acidocaldarius DSM 639]
Sequence
MQIRKVKISKVKDGYRASSEDFVAVEEPLQIFVNEKNLAIIMRTPGNDLELTLGFLYYED
YINSLRDVEEISMLSDNEIHVRLTNGKFVETRNFVINSSCGICGRGFLNAIELLKSDAKT
SNEVIISLPEKLRSNQGVFNITGGLHAAALFTLSGELISIYEDVGRHNAVDKIIGSLIHK
RRLPFTEGILQVSGRIGYEIVSKAIKAGIPIISGISAPTSKAIEIAEDAGATLVGFVRGN
SFNVYTHPERIDL
Download sequence
Identical sequences A0A0U3FXK9 M1I1W0 M1I9P2 Q4JBU5
WP_011277236.1.100797 WP_011277236.1.13097 WP_011277236.1.15291 WP_011277236.1.18585 WP_011277236.1.18739 WP_011277236.1.19907 WP_011277236.1.20267 WP_011277236.1.24072 WP_011277236.1.28054 WP_011277236.1.29213 WP_011277236.1.30898 WP_011277236.1.31299 WP_011277236.1.3283 WP_011277236.1.33024 WP_011277236.1.33782 WP_011277236.1.34459 WP_011277236.1.34536 WP_011277236.1.35781 WP_011277236.1.35800 WP_011277236.1.36276 WP_011277236.1.37881 WP_011277236.1.38112 WP_011277236.1.38253 WP_011277236.1.39308 WP_011277236.1.39398 WP_011277236.1.43265 WP_011277236.1.4394 WP_011277236.1.45682 WP_011277236.1.48356 WP_011277236.1.49892 WP_011277236.1.50721 WP_011277236.1.51246 WP_011277236.1.5150 WP_011277236.1.53520 WP_011277236.1.55288 WP_011277236.1.55517 WP_011277236.1.56706 WP_011277236.1.57256 WP_011277236.1.64117 WP_011277236.1.64360 WP_011277236.1.67449 WP_011277236.1.68798 WP_011277236.1.7301 WP_011277236.1.74875 WP_011277236.1.78046 WP_011277236.1.78998 WP_011277236.1.8042 WP_011277236.1.83345 WP_011277236.1.87279 WP_011277236.1.90653 WP_011277236.1.90680 WP_011277236.1.95134 WP_011277236.1.96274 WP_011277236.1.97501 gi|449068635|ref|YP_007435716.1| gi|449066359|ref|YP_007433441.1| 330779.Saci_0318 gi|70606157|ref|YP_255027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]