SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606188|ref|YP_255058.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606188|ref|YP_255058.1|
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily Single hybrid motif 2.75e-23
Family Biotinyl/lipoyl-carrier proteins and domains 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70606188|ref|YP_255058.1|
Sequence length 146
Comment glycine cleavage H-protein [Sulfolobus acidocaldarius DSM 639]
Sequence
MKISFFNFPDDLLYEPERHVWIKVEENKVVSVGMTDLGQYLAGKIFQVSVPRRVGERVNN
RTILFSVESAKWIGKIRLQIEGEVVDINERVIKNPSIINEDPYGSWIIKVSVTDVDLVKR
AFKNIQDCRSQFEEEANRIVSWKNSS
Download sequence
Identical sequences A0A0U3FNE1 M1I1Y6 M1I9T7 Q4JBR4
gi|449066389|ref|YP_007433471.1| WP_011277267.1.100797 WP_011277267.1.13097 WP_011277267.1.15291 WP_011277267.1.18585 WP_011277267.1.18739 WP_011277267.1.19907 WP_011277267.1.20267 WP_011277267.1.24072 WP_011277267.1.28054 WP_011277267.1.29213 WP_011277267.1.30898 WP_011277267.1.31299 WP_011277267.1.3283 WP_011277267.1.33024 WP_011277267.1.33782 WP_011277267.1.34459 WP_011277267.1.34536 WP_011277267.1.35781 WP_011277267.1.35800 WP_011277267.1.36276 WP_011277267.1.37881 WP_011277267.1.38112 WP_011277267.1.38253 WP_011277267.1.39308 WP_011277267.1.39398 WP_011277267.1.43265 WP_011277267.1.4394 WP_011277267.1.45682 WP_011277267.1.48356 WP_011277267.1.49892 WP_011277267.1.50721 WP_011277267.1.51246 WP_011277267.1.5150 WP_011277267.1.53520 WP_011277267.1.55288 WP_011277267.1.55517 WP_011277267.1.56706 WP_011277267.1.57256 WP_011277267.1.64117 WP_011277267.1.64360 WP_011277267.1.67449 WP_011277267.1.68798 WP_011277267.1.7301 WP_011277267.1.74875 WP_011277267.1.78046 WP_011277267.1.78998 WP_011277267.1.8042 WP_011277267.1.83345 WP_011277267.1.87279 WP_011277267.1.90653 WP_011277267.1.90680 WP_011277267.1.95134 WP_011277267.1.96274 WP_011277267.1.97501 330779.Saci_0349 gi|449068665|ref|YP_007435746.1| gi|70606188|ref|YP_255058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]