SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606189|ref|YP_255059.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606189|ref|YP_255059.1|
Domain Number 1 Region: 10-136
Classification Level Classification E-value
Superfamily Single hybrid motif 1.57e-33
Family Biotinyl/lipoyl-carrier proteins and domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70606189|ref|YP_255059.1|
Sequence length 149
Comment glycine cleavage system protein H [Sulfolobus acidocaldarius DSM 639]
Sequence
MVVEANCEIPENLYYYIDGKNTVWVKIEGSDIAVVGITDLAQTMAGKIVKIRIKKKGIKV
ERGRPVATLESGKWAGPVPAPVSGEVVDSNSEVEKSPVILNRDPYGQGWIAKIKISNQEE
VKQLLTGQQAIQKLKEIITSEKLTCKRLQ
Download sequence
Identical sequences A0A0U2N9U9 M1ISH4 M1IZH9 Q4JBR3
330779.Saci_0350 gi|449068666|ref|YP_007435747.1| WP_011277268.1.100797 WP_011277268.1.13097 WP_011277268.1.15291 WP_011277268.1.18585 WP_011277268.1.18739 WP_011277268.1.19907 WP_011277268.1.20267 WP_011277268.1.24072 WP_011277268.1.28054 WP_011277268.1.29213 WP_011277268.1.30898 WP_011277268.1.31299 WP_011277268.1.3283 WP_011277268.1.33024 WP_011277268.1.33782 WP_011277268.1.34459 WP_011277268.1.34536 WP_011277268.1.35781 WP_011277268.1.35800 WP_011277268.1.36276 WP_011277268.1.37881 WP_011277268.1.38112 WP_011277268.1.38253 WP_011277268.1.39308 WP_011277268.1.39398 WP_011277268.1.43265 WP_011277268.1.4394 WP_011277268.1.45682 WP_011277268.1.48356 WP_011277268.1.49892 WP_011277268.1.50721 WP_011277268.1.51246 WP_011277268.1.5150 WP_011277268.1.53520 WP_011277268.1.55288 WP_011277268.1.55517 WP_011277268.1.56706 WP_011277268.1.57256 WP_011277268.1.64117 WP_011277268.1.64360 WP_011277268.1.67449 WP_011277268.1.68798 WP_011277268.1.7301 WP_011277268.1.74875 WP_011277268.1.78046 WP_011277268.1.78998 WP_011277268.1.8042 WP_011277268.1.83345 WP_011277268.1.87279 WP_011277268.1.90653 WP_011277268.1.90680 WP_011277268.1.95134 WP_011277268.1.96274 WP_011277268.1.97501 gi|70606189|ref|YP_255059.1| gi|449066390|ref|YP_007433472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]