SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606211|ref|YP_255081.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606211|ref|YP_255081.1|
Domain Number 1 Region: 183-430
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.01e-87
Family Leukotriene A4 hydrolase catalytic domain 0.00086
Further Details:      
 
Domain Number 2 Region: 3-174
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 9.15e-45
Family Leukotriene A4 hydrolase N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70606211|ref|YP_255081.1|
Sequence length 782
Comment leucyl aminopeptidase [Sulfolobus acidocaldarius DSM 639]
Sequence
MQISKYEVYLDFDFKNLSYRGKEKIYCSLDDELVLDAIGFSIHSVRINGKEIDYNYDGEK
LRIKTGKFDGTIEVDFTGKVRERELVGIYKAPYDGGKNYIVSTQFESNHARKFIPCVDHP
SYKAVFKIQVRVDKDLDVISNMPIQKVTEEGDKKLVEFYETPKMSTYLLYLGVGKFEEIK
DELDGIQVIVASVPGKISKGRFSLEVGKKVINFYNEYFGIKYQLPKEHLIAIPEFAFGAM
ENWGAITFRETALLADEKSSVIQRMRVAEVVAHELAHQWFGDLVTMKWWDDLWLNESFAT
FMSYKAIDHLFPNWDMFGDFIHSETSGAMLRDSLSTTHPIEAHVKSPEEIEQIFDDISYG
KGASILRMIEGYMGKEAFQKGIQNYLQKYKFSNAEGQDFWNSLQEASGLPIADVVKDWIT
KRGYPAVKVEVEGTKIRLYQERFSLTPLNENTTYLIPLTLEVNGKRITQLMKEQSMTIDV
GSEVKSLKVNLDRVGFYRVEYDNLDLFLNANPNHYERWGLLDDYYNLLLAGRISYEVYEN
AVKELMNDDNYLVVDEIRGQLFFLWTVNPSKYTLITDFLELQLPKWSKRTDDLSQRVYGN
LLRSFAYVDDRFAQGLSISFDNYDSLNPNLKEAVAIAYAITQGENGYDELLRKYREEKFD
EEKQRILNAMLSFREPYLVVNTLSLALNGEIKRQDTARIIPLASANPYSRFAVWRWTKTY
MEFLRSIYAGTGILGRSFRGAIPYLGLNIPEVEEYFTSNKFPEMEVEIKSALEILKALKR
LS
Download sequence
Identical sequences A0A0U3HAK8 M1ISY6 M1J002 Q4JBP1
gi|70606211|ref|YP_255081.1| WP_011277290.1.100797 WP_011277290.1.13097 WP_011277290.1.15291 WP_011277290.1.18585 WP_011277290.1.18739 WP_011277290.1.19907 WP_011277290.1.20267 WP_011277290.1.24072 WP_011277290.1.28054 WP_011277290.1.29213 WP_011277290.1.30898 WP_011277290.1.31299 WP_011277290.1.3283 WP_011277290.1.33024 WP_011277290.1.33782 WP_011277290.1.34459 WP_011277290.1.34536 WP_011277290.1.35781 WP_011277290.1.35800 WP_011277290.1.36276 WP_011277290.1.37881 WP_011277290.1.38112 WP_011277290.1.38253 WP_011277290.1.39308 WP_011277290.1.39398 WP_011277290.1.43265 WP_011277290.1.4394 WP_011277290.1.45682 WP_011277290.1.48356 WP_011277290.1.49892 WP_011277290.1.50721 WP_011277290.1.51246 WP_011277290.1.5150 WP_011277290.1.53520 WP_011277290.1.55288 WP_011277290.1.55517 WP_011277290.1.56706 WP_011277290.1.57256 WP_011277290.1.64117 WP_011277290.1.64360 WP_011277290.1.67449 WP_011277290.1.68798 WP_011277290.1.7301 WP_011277290.1.74875 WP_011277290.1.78046 WP_011277290.1.78998 WP_011277290.1.8042 WP_011277290.1.83345 WP_011277290.1.87279 WP_011277290.1.90653 WP_011277290.1.90680 WP_011277290.1.95134 WP_011277290.1.96274 WP_011277290.1.97501 gi|449068688|ref|YP_007435769.1| 330779.Saci_0372 gi|449066412|ref|YP_007433494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]