SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606284|ref|YP_255154.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606284|ref|YP_255154.1|
Domain Number 1 Region: 66-106
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000305
Family Recombinase DNA-binding domain 0.04
Further Details:      
 
Weak hits

Sequence:  gi|70606284|ref|YP_255154.1|
Domain Number - Region: 30-71
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.000118
Family YlxM/p13-like 0.059
Further Details:      
 
Domain Number - Region: 113-154
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000896
Family Tetracyclin repressor-like, N-terminal domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70606284|ref|YP_255154.1|
Sequence length 162
Comment SRSR-binding protein [Sulfolobus acidocaldarius DSM 639]
Sequence
MKFNNTKIGKKFILKNVDSSIMTEASVDELKRLYNQGKSMKSIARELGISYTKVRNILLN
AGVNIRKKRINEQEVVELAKQGHSARYISKMLKISESSALRILKKHNVGRKIKKLSDEDI
NKIKEMYLKGESIYRIAKTLGKSTNLVVYHLKRLGVYKRGYT
Download sequence
Identical sequences A0A0U3HAC8 M1INE5 M1J061 Q4JBG8
gi|70606284|ref|YP_255154.1| WP_011277363.1.100797 WP_011277363.1.13097 WP_011277363.1.15291 WP_011277363.1.18585 WP_011277363.1.18739 WP_011277363.1.19907 WP_011277363.1.20267 WP_011277363.1.24072 WP_011277363.1.28054 WP_011277363.1.29213 WP_011277363.1.30898 WP_011277363.1.31299 WP_011277363.1.3283 WP_011277363.1.33024 WP_011277363.1.33782 WP_011277363.1.34459 WP_011277363.1.34536 WP_011277363.1.35781 WP_011277363.1.35800 WP_011277363.1.36276 WP_011277363.1.37881 WP_011277363.1.38112 WP_011277363.1.38253 WP_011277363.1.39308 WP_011277363.1.39398 WP_011277363.1.43265 WP_011277363.1.4394 WP_011277363.1.45682 WP_011277363.1.48356 WP_011277363.1.49892 WP_011277363.1.50721 WP_011277363.1.51246 WP_011277363.1.5150 WP_011277363.1.53520 WP_011277363.1.55288 WP_011277363.1.55517 WP_011277363.1.56706 WP_011277363.1.57256 WP_011277363.1.64117 WP_011277363.1.64360 WP_011277363.1.67449 WP_011277363.1.68798 WP_011277363.1.7301 WP_011277363.1.74875 WP_011277363.1.78046 WP_011277363.1.78998 WP_011277363.1.8042 WP_011277363.1.83345 WP_011277363.1.87279 WP_011277363.1.90653 WP_011277363.1.90680 WP_011277363.1.95134 WP_011277363.1.96274 WP_011277363.1.97501 gi|449068763|ref|YP_007435844.1| 330779.Saci_0449 gi|449066488|ref|YP_007433570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]