SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606508|ref|YP_255378.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606508|ref|YP_255378.1|
Domain Number 1 Region: 8-447
Classification Level Classification E-value
Superfamily L-aspartase-like 6.13e-120
Family L-aspartase/fumarase 0.0000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70606508|ref|YP_255378.1|
Sequence length 452
Comment adenylosuccinate lyase [Sulfolobus acidocaldarius DSM 639]
Sequence
MDDDICVLEWRYGSKEMRQLFSRKNIVKTMAEVEIALLYALSKLGLIKETDVKKVEDIID
KIDLNRVDELERKLGHDVMALTVHMAELSGEAGDFIHFGATSNDIIDTTNAIIVKKALEI
VKKKLRDVITILIEYSRKYKDTIMVGRTHGQHALPITLGFKFANYVYEYSRSLERIYELE
KRVVRIKMAGAVGTMAAWKGHGTTIEKYVSERLGIPSHIITTQVTPRDGFAELISDLAIL
GSQLDRFALELRELMRPEIRELAEGDASKRVGSSTMPQKENPVNAEKISGLAKVLRGLVI
SEMENIPLWHERDLTNSSSERIIISHSFLIIDEMLDSMLKILKNLVVNQDQMQKNLSLSK
GLTMAESLMINLTLNGMPRHKAHELTMELSRIASNTGKSLLEVAKENETVMKIIGDENKI
KEVLNPSKYLGEYEKLIERAISYAEEILNTYV
Download sequence
Identical sequences Q4JAU4
gi|70606508|ref|YP_255378.1| 330779.Saci_0706 WP_011277587.1.100797 WP_011277587.1.13097 WP_011277587.1.15291 WP_011277587.1.18585 WP_011277587.1.18739 WP_011277587.1.19907 WP_011277587.1.20267 WP_011277587.1.24072 WP_011277587.1.28054 WP_011277587.1.29213 WP_011277587.1.30898 WP_011277587.1.31299 WP_011277587.1.3283 WP_011277587.1.33024 WP_011277587.1.33782 WP_011277587.1.34459 WP_011277587.1.34536 WP_011277587.1.35781 WP_011277587.1.35800 WP_011277587.1.36276 WP_011277587.1.37881 WP_011277587.1.38112 WP_011277587.1.38253 WP_011277587.1.39308 WP_011277587.1.39398 WP_011277587.1.43265 WP_011277587.1.4394 WP_011277587.1.45682 WP_011277587.1.48356 WP_011277587.1.49892 WP_011277587.1.50721 WP_011277587.1.51246 WP_011277587.1.5150 WP_011277587.1.53520 WP_011277587.1.55288 WP_011277587.1.55517 WP_011277587.1.56706 WP_011277587.1.57256 WP_011277587.1.64117 WP_011277587.1.64360 WP_011277587.1.67449 WP_011277587.1.68798 WP_011277587.1.7301 WP_011277587.1.74875 WP_011277587.1.78046 WP_011277587.1.78998 WP_011277587.1.8042 WP_011277587.1.83345 WP_011277587.1.87279 WP_011277587.1.90653 WP_011277587.1.90680 WP_011277587.1.95134 WP_011277587.1.96274 WP_011277587.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]