SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606521|ref|YP_255391.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606521|ref|YP_255391.1|
Domain Number 1 Region: 5-165
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 1.96e-57
Family Bacterial fluorinating enzyme, N-terminal domain 0.00053
Further Details:      
 
Domain Number 2 Region: 180-267
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 6.28e-22
Family Bacterial fluorinating enzyme, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70606521|ref|YP_255391.1|
Sequence length 278
Comment hypothetical protein Saci_0719 [Sulfolobus acidocaldarius DSM 639]
Sequence
MLKRRTIAILTDYGVSDNYNGTLEGVIRKINPDIDITYITPNAKNFNIFTGAYLLNTSYR
YFKKNTIFLVIVDPGVGTQRNAILVKTNNYYFVAPDNGVLYPTIVEDNIDKIIRISNKKF
YLSESISNTFHGRDIFAPVASYISVGVDLNVFGEEISKSEIVKLDFSYTLERINENKVKA
CGKIVYIDHFGNIATTIRNVKLRTGEKALVSLRDKQLELRVVRTFAEGKENELVLYSNGY
GFIEIGINMSSASNILGVKEGEDVCIEAYIQEDSNHST
Download sequence
Identical sequences A0A0U3FWT8 M1IPE3 M1JB18 Q4JAT1
gi|449066733|ref|YP_007433815.1| gi|449069007|ref|YP_007436088.1| gi|70606521|ref|YP_255391.1| WP_011277600.1.100797 WP_011277600.1.13097 WP_011277600.1.15291 WP_011277600.1.18585 WP_011277600.1.18739 WP_011277600.1.19907 WP_011277600.1.20267 WP_011277600.1.24072 WP_011277600.1.28054 WP_011277600.1.29213 WP_011277600.1.30898 WP_011277600.1.31299 WP_011277600.1.3283 WP_011277600.1.33024 WP_011277600.1.33782 WP_011277600.1.34459 WP_011277600.1.34536 WP_011277600.1.35781 WP_011277600.1.35800 WP_011277600.1.36276 WP_011277600.1.37881 WP_011277600.1.38112 WP_011277600.1.38253 WP_011277600.1.39308 WP_011277600.1.39398 WP_011277600.1.43265 WP_011277600.1.4394 WP_011277600.1.45682 WP_011277600.1.48356 WP_011277600.1.49892 WP_011277600.1.50721 WP_011277600.1.51246 WP_011277600.1.5150 WP_011277600.1.53520 WP_011277600.1.55288 WP_011277600.1.55517 WP_011277600.1.56706 WP_011277600.1.57256 WP_011277600.1.64117 WP_011277600.1.64360 WP_011277600.1.67449 WP_011277600.1.68798 WP_011277600.1.7301 WP_011277600.1.74875 WP_011277600.1.78046 WP_011277600.1.78998 WP_011277600.1.8042 WP_011277600.1.83345 WP_011277600.1.87279 WP_011277600.1.90653 WP_011277600.1.90680 WP_011277600.1.95134 WP_011277600.1.96274 WP_011277600.1.97501 330779.Saci_0719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]