SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606740|ref|YP_255610.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606740|ref|YP_255610.1|
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.17e-96
Family Inorganic pyrophosphatase 0.00000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70606740|ref|YP_255610.1|
Sequence length 173
Comment inorganic pyrophosphatase [Sulfolobus acidocaldarius DSM 639]
Sequence
MKLSPGKNAPDVVNVLVEIPQGSNIKYEYDDEEGVIKVDRVLYTSMNYPFNYGFIPGTLE
EDGDPLDVLVITNYQLYPGSVIEVRPIGILYMKDEEGEDAKIVAVPKDKTDPSFSNIKDI
NDLPQATKNKIVHFFEHYKELEPGKYVKISGWGSATEAKNRIQLAIKRVSGGQ
Download sequence
Identical sequences A0A0U3FEN5 M1I3X4 M1J112 P50308 V9S885
cath|current|1qezA00/1002-1171 cath|current|1qezB00/2002-2171 cath|current|1qezC00/3002-3171 cath|current|1qezD00/4002-4171 cath|current|1qezE00/5002-5171 cath|current|1qezF00/6002-6171 330779.Saci_0955 1qezA gi|568163635|ref|YP_008946997.1| gi|449069236|ref|YP_007436317.1| gi|449066964|ref|YP_007434046.1| 1qez_A 1qez_B 1qez_C 1qez_D 1qez_E 1qez_F gi|70606740|ref|YP_255610.1| WP_011277819.1.100797 WP_011277819.1.13097 WP_011277819.1.15291 WP_011277819.1.18585 WP_011277819.1.18739 WP_011277819.1.19907 WP_011277819.1.20267 WP_011277819.1.24072 WP_011277819.1.28054 WP_011277819.1.29213 WP_011277819.1.30898 WP_011277819.1.31299 WP_011277819.1.3283 WP_011277819.1.33024 WP_011277819.1.33782 WP_011277819.1.34459 WP_011277819.1.34536 WP_011277819.1.35781 WP_011277819.1.35800 WP_011277819.1.36276 WP_011277819.1.37881 WP_011277819.1.38112 WP_011277819.1.38253 WP_011277819.1.39308 WP_011277819.1.39398 WP_011277819.1.43265 WP_011277819.1.4394 WP_011277819.1.45682 WP_011277819.1.48356 WP_011277819.1.49892 WP_011277819.1.50721 WP_011277819.1.51246 WP_011277819.1.5150 WP_011277819.1.53520 WP_011277819.1.55288 WP_011277819.1.55517 WP_011277819.1.56706 WP_011277819.1.57256 WP_011277819.1.64117 WP_011277819.1.64360 WP_011277819.1.67449 WP_011277819.1.68798 WP_011277819.1.7301 WP_011277819.1.74875 WP_011277819.1.78046 WP_011277819.1.78998 WP_011277819.1.8042 WP_011277819.1.83345 WP_011277819.1.87279 WP_011277819.1.90653 WP_011277819.1.90680 WP_011277819.1.95134 WP_011277819.1.96274 WP_011277819.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]