SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606795|ref|YP_255665.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606795|ref|YP_255665.1|
Domain Number 1 Region: 125-338
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.18e-68
Family Creatinase/aminopeptidase 0.00000328
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 2.49e-19
Family Creatinase/prolidase N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70606795|ref|YP_255665.1|
Sequence length 350
Comment X-prodipeptidase [Sulfolobus acidocaldarius DSM 639]
Sequence
MRSKLERVKEELRARNIDYLILAPGSNMLYLTGFDEEQMERPLFYIVTQNEEFFVVPKLY
EEQLSNHNLIVYTDGENPFKKIPIQKGRVVAIDDTMWSSFTIDILNYFSPSQLVKSSEVL
KEIRMIKSQEEIEILREGVKIAEEAFLETINLIREGMKEVEISNLLIQKFSERGVKPSFE
PIITSGPNTSMPHLRATNRKVARNEVIIFDFGIRYKGYATDTTRVVSIGKPNEDVLKIHE
IVREAQERAEEYVSEKVETSEVDKIARQTISKYGFGAYFIHRTGHGIGIDVHEDPYISSD
YKRPIKNNMTFTIEPGIYLPGKFGIRIEDMVFVNDKGISMNKLDKNIFTL
Download sequence
Identical sequences A0A0U2W312 M1J1T8 M1J4Z6 Q4JA08
gi|449069293|ref|YP_007436374.1| 330779.Saci_1015 gi|449067021|ref|YP_007434103.1| WP_011277874.1.13097 WP_011277874.1.18585 WP_011277874.1.19907 WP_011277874.1.24072 WP_011277874.1.28054 WP_011277874.1.30898 WP_011277874.1.33782 WP_011277874.1.35781 WP_011277874.1.37881 WP_011277874.1.38253 WP_011277874.1.39308 WP_011277874.1.45682 WP_011277874.1.48356 WP_011277874.1.51246 WP_011277874.1.53520 WP_011277874.1.64360 WP_011277874.1.67449 WP_011277874.1.68798 WP_011277874.1.87279 WP_011277874.1.90653 WP_011277874.1.90680 WP_011277874.1.96274 gi|70606795|ref|YP_255665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]