SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606849|ref|YP_255719.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606849|ref|YP_255719.1|
Domain Number 1 Region: 38-242
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 4.32e-70
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00022
Further Details:      
 
Domain Number 2 Region: 229-360
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 0.00000000000000854
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70606849|ref|YP_255719.1|
Sequence length 362
Comment isovaleryl-CoA dehydrogenase [Sulfolobus acidocaldarius DSM 639]
Sequence
MDEEEFRSALKKWIESNSPADLKGRRILFDTVEFDDYQKIREWQRKLYSAGYLGITWPKQ
YGGQDLPPIYEAIAYEEFIKAGLPYGRSLGSIGLMVAAPAILKHGNEEQKKRYLPRILSA
EDIWCQGFSEPSAGSDLASVKTRAEDKGDYFLVNGQKIWSSYAHLANYMILLARTGEDRY
GGLTMFVVDMKQPGIKVSPIYQITGKSDFNIVYLSDVKVPKENVVGKVGEGWKVAMTVLN
HERFTLGITMLFTSKSAIDTLKDPKLEELRDDIEGLEAFYRRLLIKLRRGEDVDTEGAIL
KLVASEILQKVYEHAVSNYDLEFIMSQKWYLGMLSSRGRTIAGGTSEILRNLIGERVLKL
PK
Download sequence
Identical sequences A0A0U3GEW0 M1J1Z1 M1J550 Q4J9V4
WP_011277928.1.100797 WP_011277928.1.13097 WP_011277928.1.15291 WP_011277928.1.18585 WP_011277928.1.18739 WP_011277928.1.19907 WP_011277928.1.20267 WP_011277928.1.24072 WP_011277928.1.28054 WP_011277928.1.29213 WP_011277928.1.30898 WP_011277928.1.31299 WP_011277928.1.3283 WP_011277928.1.33024 WP_011277928.1.33782 WP_011277928.1.34459 WP_011277928.1.34536 WP_011277928.1.35781 WP_011277928.1.35800 WP_011277928.1.36276 WP_011277928.1.37881 WP_011277928.1.38112 WP_011277928.1.38253 WP_011277928.1.39308 WP_011277928.1.39398 WP_011277928.1.43265 WP_011277928.1.4394 WP_011277928.1.45682 WP_011277928.1.48356 WP_011277928.1.49892 WP_011277928.1.50721 WP_011277928.1.51246 WP_011277928.1.5150 WP_011277928.1.53520 WP_011277928.1.55288 WP_011277928.1.55517 WP_011277928.1.56706 WP_011277928.1.57256 WP_011277928.1.64117 WP_011277928.1.64360 WP_011277928.1.67449 WP_011277928.1.68798 WP_011277928.1.7301 WP_011277928.1.74875 WP_011277928.1.78046 WP_011277928.1.78998 WP_011277928.1.8042 WP_011277928.1.83345 WP_011277928.1.87279 WP_011277928.1.90653 WP_011277928.1.90680 WP_011277928.1.95134 WP_011277928.1.96274 WP_011277928.1.97501 gi|449069348|ref|YP_007436429.1| 330779.Saci_1069 gi|70606849|ref|YP_255719.1| gi|449067076|ref|YP_007434158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]