SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606869|ref|YP_255739.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606869|ref|YP_255739.1|
Domain Number 1 Region: 183-280
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000114
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70606869|ref|YP_255739.1|
Sequence length 286
Comment hypothetical protein Saci_1092 [Sulfolobus acidocaldarius DSM 639]
Sequence
MYSKDFTGSVMQRDTITFFKWIIPLSLAWGIAYPLTKVVTFSVSPILVSVARVIVGTLFF
YFLGRGFSIGIKQFVNALFNVIILLALVNVGIYLSPSPGLVATMIYTQPIFVLVIELILG
SKISLRGMSGVVIGVLGVLISATLSFNIGLLFGIMGSLSWAIGTVYYYRNLSKDNVIKLN
AFMSLISIPFLSSLTPLDYYFDFNVTSVVLLIILALIAQVAGFYFWFNAVRDLGSVSAST
GSLLVPVIAYLTSILILKVVPNVPEIIGLILILVGVYLSLNSRKGK
Download sequence
Identical sequences A0A0U2WZ24 M1IV01 M1IXV9 Q4J9T4
gi|449067097|ref|YP_007434179.1| GO.5165 gi|70606869|ref|YP_255739.1| WP_011277948.1.100797 WP_011277948.1.13097 WP_011277948.1.15291 WP_011277948.1.18585 WP_011277948.1.18739 WP_011277948.1.19907 WP_011277948.1.20267 WP_011277948.1.24072 WP_011277948.1.28054 WP_011277948.1.29213 WP_011277948.1.30898 WP_011277948.1.31299 WP_011277948.1.3283 WP_011277948.1.33024 WP_011277948.1.33782 WP_011277948.1.34459 WP_011277948.1.34536 WP_011277948.1.35781 WP_011277948.1.35800 WP_011277948.1.36276 WP_011277948.1.37881 WP_011277948.1.38112 WP_011277948.1.38253 WP_011277948.1.39308 WP_011277948.1.39398 WP_011277948.1.43265 WP_011277948.1.4394 WP_011277948.1.45682 WP_011277948.1.48356 WP_011277948.1.49892 WP_011277948.1.50721 WP_011277948.1.51246 WP_011277948.1.5150 WP_011277948.1.55288 WP_011277948.1.55517 WP_011277948.1.56706 WP_011277948.1.57256 WP_011277948.1.64117 WP_011277948.1.64360 WP_011277948.1.67449 WP_011277948.1.68798 WP_011277948.1.7301 WP_011277948.1.74875 WP_011277948.1.78046 WP_011277948.1.78998 WP_011277948.1.8042 WP_011277948.1.83345 WP_011277948.1.87279 WP_011277948.1.90653 WP_011277948.1.90680 WP_011277948.1.95134 WP_011277948.1.96274 WP_011277948.1.97501 gi|449069369|ref|YP_007436450.1| 330779.Saci_1092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]