SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606878|ref|YP_255748.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606878|ref|YP_255748.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.88e-69
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000103
Further Details:      
 
Domain Number 2 Region: 252-463
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 8.58e-57
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70606878|ref|YP_255748.1|
Sequence length 463
Comment hydroxylase [Sulfolobus acidocaldarius DSM 639]
Sequence
MRTKGDFLKSLRDGRKVFYRGKPVEDITAHPILSIAAIHASKLFEYSDRMYEDPSLGKVS
KFFKKPTSTQDLLERHKLIYDTTMYCNGIFNISQAIGSDAIFALTITARQLDRKYGTDYT
KRIQKYHEYVTKNDLTIATAQTDVKGDRSKRPSEQADPDMYVRIVDVKSDGIVVRGAKAH
TTQSAVSDEIIVIPTRAMKDSDKDYAVAFAVPANAPGLKLYVRPIDEIEGNTSAVLSKKD
YELETITVFDNVFVPWDRVFLFKEYDYAGNIAMLFATYHRFTALSYRSALINLFLGSARV
MAKANGIENEKHVRDDVVDLILYKEILRSTAITSAISPVMLEGVAVPNPLYVNVGKLYSN
MHFHDVIKDLVDVAGGIIATLPSQEDFDSEEGKTIIKYLRGAVDGEERVKILKLVKELAA
SPVAGYLLTAMVHAEGSIEASKIELFRSYDYREAESLIKKIIG
Download sequence
Identical sequences A0A0U2N8T2 M1J220 M1J578 Q4J9S5
gi|449067106|ref|YP_007434188.1| 330779.Saci_1103 WP_011277957.1.100797 WP_011277957.1.13097 WP_011277957.1.15291 WP_011277957.1.18585 WP_011277957.1.18739 WP_011277957.1.19907 WP_011277957.1.20267 WP_011277957.1.24072 WP_011277957.1.28054 WP_011277957.1.29213 WP_011277957.1.30898 WP_011277957.1.31299 WP_011277957.1.3283 WP_011277957.1.33024 WP_011277957.1.33782 WP_011277957.1.34459 WP_011277957.1.34536 WP_011277957.1.35781 WP_011277957.1.35800 WP_011277957.1.36276 WP_011277957.1.37881 WP_011277957.1.38112 WP_011277957.1.38253 WP_011277957.1.39308 WP_011277957.1.39398 WP_011277957.1.43265 WP_011277957.1.4394 WP_011277957.1.45682 WP_011277957.1.48356 WP_011277957.1.49892 WP_011277957.1.50721 WP_011277957.1.51246 WP_011277957.1.5150 WP_011277957.1.53520 WP_011277957.1.55288 WP_011277957.1.55517 WP_011277957.1.56706 WP_011277957.1.57256 WP_011277957.1.64117 WP_011277957.1.64360 WP_011277957.1.67449 WP_011277957.1.68798 WP_011277957.1.7301 WP_011277957.1.74875 WP_011277957.1.78046 WP_011277957.1.78998 WP_011277957.1.8042 WP_011277957.1.83345 WP_011277957.1.87279 WP_011277957.1.90653 WP_011277957.1.90680 WP_011277957.1.95134 WP_011277957.1.96274 WP_011277957.1.97501 gi|70606878|ref|YP_255748.1| gi|449069378|ref|YP_007436459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]