SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70606883|ref|YP_255753.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70606883|ref|YP_255753.1|
Domain Number 1 Region: 5-241
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.69e-71
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00038
Further Details:      
 
Domain Number 2 Region: 228-371
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 3.54e-17
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70606883|ref|YP_255753.1|
Sequence length 373
Comment acyl-CoA dehydrogenase [Sulfolobus acidocaldarius DSM 639]
Sequence
MGEEDKELEEYRNKVREWIRKNVPEEIKEKGDMAPVEVLKSWQRKIYEAGYLGVSWPKEY
GGWGDSPIKEIIVREEFAKAGVPYATIGLGVSVTGPAILNNGNEEQKKKHIRRILTAEDI
WCQGFSEPHAGSDLASIRTKIEDKGDHYEVNGQKIWSSYAHLANYCLLLGRTGDPSERHK
GLTILIVDMRSEGIKVSPIKQITGRSEFNTVYFNQVKVPKENVVGKVGEGWRVAMSTLNY
ERLNIGTILFGVERIIRDLVNTGYKGESLINTAEDIIALKAFYKRILERMKKGYIAGPEA
AMIKLVASESMQKVYESAFNTMGPEALVVERKPGFRPEIVYGLLASRSITIAGGTSEILR
NLLGEVVLGLPKG
Download sequence
Identical sequences A0A0U3GJX0 M1J225 M1J585 Q4J9S0
330779.Saci_1108 gi|70606883|ref|YP_255753.1| gi|449067111|ref|YP_007434193.1| gi|449069383|ref|YP_007436464.1| WP_011277962.1.100797 WP_011277962.1.13097 WP_011277962.1.15291 WP_011277962.1.18585 WP_011277962.1.18739 WP_011277962.1.19907 WP_011277962.1.20267 WP_011277962.1.24072 WP_011277962.1.28054 WP_011277962.1.29213 WP_011277962.1.30898 WP_011277962.1.31299 WP_011277962.1.3283 WP_011277962.1.33024 WP_011277962.1.33782 WP_011277962.1.34459 WP_011277962.1.34536 WP_011277962.1.35781 WP_011277962.1.35800 WP_011277962.1.36276 WP_011277962.1.37881 WP_011277962.1.38112 WP_011277962.1.38253 WP_011277962.1.39308 WP_011277962.1.39398 WP_011277962.1.43265 WP_011277962.1.4394 WP_011277962.1.45682 WP_011277962.1.48356 WP_011277962.1.49892 WP_011277962.1.50721 WP_011277962.1.51246 WP_011277962.1.5150 WP_011277962.1.53520 WP_011277962.1.55288 WP_011277962.1.55517 WP_011277962.1.56706 WP_011277962.1.57256 WP_011277962.1.64117 WP_011277962.1.64360 WP_011277962.1.67449 WP_011277962.1.68798 WP_011277962.1.7301 WP_011277962.1.74875 WP_011277962.1.78046 WP_011277962.1.78998 WP_011277962.1.8042 WP_011277962.1.83345 WP_011277962.1.87279 WP_011277962.1.90653 WP_011277962.1.90680 WP_011277962.1.95134 WP_011277962.1.96274 WP_011277962.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]