SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607024|ref|YP_255894.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607024|ref|YP_255894.1|
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Flavoproteins 6.64e-50
Family NADPH-dependent FMN reductase 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70607024|ref|YP_255894.1|
Sequence length 191
Comment NADPH-dependent FMN reductase [Sulfolobus acidocaldarius DSM 639]
Sequence
MSHIKILGIPGSIRKNSYNKLLLKATLNLLPQGVEMEIFEDISQIPPFNQDEENNPPQVV
KDLKRKIRESDAILFATPEYNRSIPGVLKNAIDWASRPYMDNSFNGKVAAIMSASIGMLG
GALAHYHLKQILSFLNVNVVTGPEVFVSFAQQKFDENGNLVDENSKKFISQLLTNLVDYV
KMVKSKQVVSL
Download sequence
Identical sequences A0A0U3H1E1 M1IVJ8 M1J2I0 Q4J9C9
330779.Saci_1255 gi|449067257|ref|YP_007434339.1| gi|70607024|ref|YP_255894.1| WP_011278103.1.100797 WP_011278103.1.13097 WP_011278103.1.15291 WP_011278103.1.18585 WP_011278103.1.18739 WP_011278103.1.19907 WP_011278103.1.20267 WP_011278103.1.24072 WP_011278103.1.28054 WP_011278103.1.29213 WP_011278103.1.30898 WP_011278103.1.31299 WP_011278103.1.3283 WP_011278103.1.33024 WP_011278103.1.33782 WP_011278103.1.34459 WP_011278103.1.34536 WP_011278103.1.35781 WP_011278103.1.35800 WP_011278103.1.36276 WP_011278103.1.37881 WP_011278103.1.38112 WP_011278103.1.38253 WP_011278103.1.39308 WP_011278103.1.39398 WP_011278103.1.43265 WP_011278103.1.4394 WP_011278103.1.45682 WP_011278103.1.48356 WP_011278103.1.49892 WP_011278103.1.50721 WP_011278103.1.51246 WP_011278103.1.5150 WP_011278103.1.53520 WP_011278103.1.55288 WP_011278103.1.55517 WP_011278103.1.56706 WP_011278103.1.57256 WP_011278103.1.64117 WP_011278103.1.64360 WP_011278103.1.67449 WP_011278103.1.68798 WP_011278103.1.7301 WP_011278103.1.74875 WP_011278103.1.78046 WP_011278103.1.78998 WP_011278103.1.8042 WP_011278103.1.83345 WP_011278103.1.87279 WP_011278103.1.90653 WP_011278103.1.90680 WP_011278103.1.95134 WP_011278103.1.96274 WP_011278103.1.97501 gi|449069528|ref|YP_007436609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]