SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607086|ref|YP_255956.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607086|ref|YP_255956.1|
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily GlnB-like 1.3e-37
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70607086|ref|YP_255956.1|
Sequence length 110
Comment divalent cation tolerance protein [Sulfolobus acidocaldarius DSM 639]
Sequence
MTYILVLTTTNTMESANKIAKTLVDERVAACVNIFPYIKSYYVWEGKTTVDDEILLLIKS
HNSMTQKLIQRIKELHPYKIPEIIIINFNEGFDKYLDWIKESVTLDENKD
Download sequence
Identical sequences A0A0U3H8H6 M1J232 M1J5T7 Q4J969
gi|70607086|ref|YP_255956.1| gi|449067326|ref|YP_007434408.1| gi|449069596|ref|YP_007436677.1| WP_011278165.1.100797 WP_011278165.1.13097 WP_011278165.1.15291 WP_011278165.1.18585 WP_011278165.1.18739 WP_011278165.1.19907 WP_011278165.1.20267 WP_011278165.1.24072 WP_011278165.1.28054 WP_011278165.1.29213 WP_011278165.1.30898 WP_011278165.1.31299 WP_011278165.1.3283 WP_011278165.1.33024 WP_011278165.1.33782 WP_011278165.1.34459 WP_011278165.1.34536 WP_011278165.1.35781 WP_011278165.1.35800 WP_011278165.1.36276 WP_011278165.1.37881 WP_011278165.1.38112 WP_011278165.1.38253 WP_011278165.1.39308 WP_011278165.1.39398 WP_011278165.1.43265 WP_011278165.1.4394 WP_011278165.1.45682 WP_011278165.1.48356 WP_011278165.1.49892 WP_011278165.1.50721 WP_011278165.1.51246 WP_011278165.1.5150 WP_011278165.1.53520 WP_011278165.1.55288 WP_011278165.1.55517 WP_011278165.1.56706 WP_011278165.1.57256 WP_011278165.1.64117 WP_011278165.1.64360 WP_011278165.1.67449 WP_011278165.1.68798 WP_011278165.1.7301 WP_011278165.1.74875 WP_011278165.1.78046 WP_011278165.1.78998 WP_011278165.1.8042 WP_011278165.1.83345 WP_011278165.1.87279 WP_011278165.1.90653 WP_011278165.1.90680 WP_011278165.1.95134 WP_011278165.1.96274 WP_011278165.1.97501 330779.Saci_1328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]