SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607140|ref|YP_256010.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607140|ref|YP_256010.1|
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily Single hybrid motif 7.12e-41
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70607140|ref|YP_256010.1|
Sequence length 138
Comment glycine cleavage system protein H [Sulfolobus acidocaldarius DSM 639]
Sequence
MSVVIDGKYLILKDRHYTETDEWILINGNIATVGITDYAQKKLKDIVGIELPQVGREVTI
GEQVAVVESVKAAADIFSPLSGSVLEVNKELQSSPETINKDPYGRGWIFKLKIKDEKEVS
KLLNFEQYIISIKQREGI
Download sequence
Identical sequences A0A0U3H8A3 M1ID69 M1IVH6 Q4J912
330779.Saci_1384 gi|449067380|ref|YP_007434462.1| gi|70607140|ref|YP_256010.1| WP_011278219.1.100797 WP_011278219.1.13097 WP_011278219.1.15291 WP_011278219.1.18585 WP_011278219.1.18739 WP_011278219.1.19907 WP_011278219.1.20267 WP_011278219.1.24072 WP_011278219.1.28054 WP_011278219.1.29213 WP_011278219.1.30898 WP_011278219.1.31299 WP_011278219.1.3283 WP_011278219.1.33024 WP_011278219.1.33782 WP_011278219.1.34459 WP_011278219.1.34536 WP_011278219.1.35781 WP_011278219.1.35800 WP_011278219.1.36276 WP_011278219.1.37881 WP_011278219.1.38112 WP_011278219.1.38253 WP_011278219.1.39308 WP_011278219.1.39398 WP_011278219.1.43265 WP_011278219.1.4394 WP_011278219.1.45682 WP_011278219.1.48356 WP_011278219.1.49892 WP_011278219.1.50721 WP_011278219.1.51246 WP_011278219.1.5150 WP_011278219.1.53520 WP_011278219.1.55288 WP_011278219.1.55517 WP_011278219.1.56706 WP_011278219.1.57256 WP_011278219.1.64117 WP_011278219.1.64360 WP_011278219.1.67449 WP_011278219.1.68798 WP_011278219.1.7301 WP_011278219.1.74875 WP_011278219.1.78046 WP_011278219.1.78998 WP_011278219.1.8042 WP_011278219.1.83345 WP_011278219.1.87279 WP_011278219.1.90653 WP_011278219.1.90680 WP_011278219.1.95134 WP_011278219.1.96274 WP_011278219.1.97501 gi|449069650|ref|YP_007436731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]