SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70607141|ref|YP_256011.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607141|ref|YP_256011.1|
Domain Number 1 Region: 5-235
Classification Level Classification E-value
Superfamily Cgl1923-like 1.83e-39
Family Cgl1923-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70607141|ref|YP_256011.1|
Sequence length 248
Comment hypothetical protein Saci_1385 [Sulfolobus acidocaldarius DSM 639]
Sequence
MSSVEILEDYIPQLTRPSYLIVGLPDAGLVGTIATEFLVKKLGLSEFATIYAPDILPPIM
HVRDGIAKSPLKFYHNGKNMIVFHSYIALPFSVINQIAKTLIDFAKKYGINNIISITGIP
VENRLSATTLNSFVIGNNQQVTEEIEKMGLSKKFGEGYIAGPYAPILSYSQREKLNNIII
VVESFMDLPDPEASAIALSILSKYIGFPLDTEELLKEAEEVRERIRGLMSQTREELPKYA
TGRPMTYA
Download sequence
Identical sequences M1J2A9 M1J5Z5 Q4J913
gi|449067381|ref|YP_007434463.1| WP_011278220.1.18585 WP_011278220.1.19907 WP_011278220.1.37881 WP_011278220.1.39308 WP_011278220.1.48356 WP_011278220.1.64360 WP_011278220.1.68798 WP_011278220.1.87279 330779.Saci_1385 gi|70607141|ref|YP_256011.1| gi|449069651|ref|YP_007436732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]